FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3020, 125 aa 1>>>pF1KE3020 125 - 125 aa - 125 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.6589+/-0.000247; mu= 11.0994+/- 0.016 mean_var=93.7157+/-18.768, 0's: 0 Z-trim(123.3): 2 B-trim: 0 in 0/56 Lambda= 0.132485 statistics sampled from 42746 (42750) to 42746 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.837), E-opt: 0.2 (0.501), width: 16 Scan time: 5.550 The best scores are: opt bits E(85289) NP_683694 (OMIM: 607996) neuropeptide B preproprot ( 125) 847 170.3 7.2e-43 NP_001092926 (OMIM: 607997) neuropeptide W preprop ( 165) 173 41.6 0.00053 >>NP_683694 (OMIM: 607996) neuropeptide B preproprotein (125 aa) initn: 847 init1: 847 opt: 847 Z-score: 890.6 bits: 170.3 E(85289): 7.2e-43 Smith-Waterman score: 847; 100.0% identity (100.0% similar) in 125 aa overlap (1-125:1-125) 10 20 30 40 50 60 pF1KE3 MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_683 MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYR 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 GAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_683 GAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAA 70 80 90 100 110 120 pF1KE3 DCLAA ::::: NP_683 DCLAA >>NP_001092926 (OMIM: 607997) neuropeptide W preproprote (165 aa) initn: 170 init1: 170 opt: 173 Z-score: 192.8 bits: 41.6 E(85289): 0.00053 Smith-Waterman score: 173; 53.1% identity (64.1% similar) in 64 aa overlap (11-73:18-81) 10 20 30 40 50 pF1KE3 MARSATLAAAALALCLLLAP-PGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPY :: : ::: : :. :::: .:. ..:::::::: ::::::: NP_001 MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAGLLMGLRRSPY 10 20 30 40 50 60 60 70 80 90 100 110 pF1KE3 ARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKAN : .: : . ::: NP_001 LWRRALRAAAGPLARDTLSPEPAAREAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRA 70 80 90 100 110 120 125 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 04:45:40 2016 done: Tue Nov 8 04:45:41 2016 Total Scan time: 5.550 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]