FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3020, 125 aa 1>>>pF1KE3020 125 - 125 aa - 125 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.9750+/-0.000546; mu= 9.3110+/- 0.033 mean_var=89.6420+/-17.826, 0's: 0 Z-trim(116.2): 5 B-trim: 0 in 0/51 Lambda= 0.135462 statistics sampled from 16779 (16783) to 16779 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.845), E-opt: 0.2 (0.516), width: 16 Scan time: 1.870 The best scores are: opt bits E(32554) CCDS11790.1 NPB gene_id:256933|Hs108|chr17 ( 125) 847 173.8 2.5e-44 >>CCDS11790.1 NPB gene_id:256933|Hs108|chr17 (125 aa) initn: 847 init1: 847 opt: 847 Z-score: 909.5 bits: 173.8 E(32554): 2.5e-44 Smith-Waterman score: 847; 100.0% identity (100.0% similar) in 125 aa overlap (1-125:1-125) 10 20 30 40 50 60 pF1KE3 MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS11 MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYR 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 GAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS11 GAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAA 70 80 90 100 110 120 pF1KE3 DCLAA ::::: CCDS11 DCLAA 125 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 04:45:39 2016 done: Tue Nov 8 04:45:40 2016 Total Scan time: 1.870 Total Display time: -0.050 Function used was FASTA [36.3.4 Apr, 2011]