Result of FASTA (omim) for pFN21AB6977
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB6977, 217 aa
  1>>>pF1KB6977 217 - 217 aa - 217 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.7348+/-0.000336; mu= 17.1519+/- 0.021
 mean_var=62.2933+/-12.599, 0's: 0 Z-trim(114.8): 51  B-trim: 975 in 2/55
 Lambda= 0.162500
 statistics sampled from 24786 (24837) to 24786 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.675), E-opt: 0.2 (0.291), width:  16
 Scan time:  6.250

The best scores are:                                      opt bits E(85289)
NP_000506 (OMIM: 139250,173100,262400,262650,61278 ( 217) 1439 345.5   4e-95
NP_002050 (OMIM: 139240) growth hormone variant is ( 217) 1321 317.8 8.4e-87
NP_066271 (OMIM: 118820) chorionic somatomammotrop ( 217) 1229 296.3 2.6e-80
NP_001308 (OMIM: 150200) chorionic somatomammotrop ( 217) 1228 296.0 3.1e-80
NP_072101 (OMIM: 603515) chorionic somatomammotrop ( 222) 1120 270.7 1.3e-72
NP_072053 (OMIM: 139250,173100,262400,262650,61278 ( 202)  958 232.7 3.3e-61
NP_072051 (OMIM: 139240) growth hormone variant is ( 256)  904 220.1 2.6e-57
NP_072052 (OMIM: 139240) growth hormone variant is ( 245)  895 218.0 1.1e-56
NP_072050 (OMIM: 139240) growth hormone variant is ( 202)  892 217.2 1.5e-56
NP_001307998 (OMIM: 603515) chorionic somatomammot ( 183)  850 207.4 1.3e-53
NP_001307996 (OMIM: 603515) chorionic somatomammot ( 162)  843 205.7 3.6e-53
NP_072170 (OMIM: 118820) chorionic somatomammotrop ( 167)  818 199.8 2.2e-51
NP_072054 (OMIM: 139250,173100,262400,262650,61278 ( 177)  802 196.1 3.1e-50
XP_011522646 (OMIM: 603515) PREDICTED: chorionic s ( 261)  741 181.9 8.3e-46
NP_072102 (OMIM: 603515) chorionic somatomammotrop ( 139)  724 177.7 8.1e-45
NP_001307997 (OMIM: 603515) chorionic somatomammot ( 160)  724 177.8   9e-45
NP_072103 (OMIM: 603515) chorionic somatomammotrop ( 199)  724 177.8 1.1e-44
NP_001309 (OMIM: 603515) chorionic somatomammotrop ( 128)  687 169.0 3.1e-42
XP_011522648 (OMIM: 603515) PREDICTED: chorionic s ( 201)  464 116.9 2.4e-26
NP_072171 (OMIM: 118820) chorionic somatomammotrop ( 122)  421 106.6 1.8e-23
NP_000939 (OMIM: 176760) prolactin precursor [Homo ( 227)  270 71.5 1.3e-12
NP_001157030 (OMIM: 176760) prolactin precursor [H ( 227)  270 71.5 1.3e-12
XP_011513055 (OMIM: 176760) PREDICTED: prolactin i ( 228)  270 71.5 1.3e-12
XP_011513056 (OMIM: 176760) PREDICTED: prolactin i ( 228)  270 71.5 1.3e-12


>>NP_000506 (OMIM: 139250,173100,262400,262650,612781) s  (217 aa)
 initn: 1439 init1: 1439 opt: 1439  Z-score: 1828.8  bits: 345.5 E(85289): 4e-95
Smith-Waterman score: 1439; 100.0% identity (100.0% similar) in 217 aa overlap (1-217:1-217)

               10        20        30        40        50        60
pF1KB6 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_000 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
               10        20        30        40        50        60

               70        80        90       100       110       120
pF1KB6 YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_000 YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
               70        80        90       100       110       120

              130       140       150       160       170       180
pF1KB6 SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_000 SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
              130       140       150       160       170       180

              190       200       210       
pF1KB6 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
       :::::::::::::::::::::::::::::::::::::
NP_000 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
              190       200       210       

>>NP_002050 (OMIM: 139240) growth hormone variant isofor  (217 aa)
 initn: 1321 init1: 1321 opt: 1321  Z-score: 1679.3  bits: 317.8 E(85289): 8.4e-87
Smith-Waterman score: 1321; 93.1% identity (97.2% similar) in 217 aa overlap (1-217:1-217)

               10        20        30        40        50        60
pF1KB6 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
       ::.::::::::::::::: ::::::::::::::::::::::::.::.:::.:::::::::
NP_002 MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEA
               10        20        30        40        50        60

               70        80        90       100       110       120
pF1KB6 YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
       :: ::::::::::::::::::::::::::: .:::::::::::::::::::::::::.::
NP_002 YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
               70        80        90       100       110       120

              130       140       150       160       170       180
pF1KB6 SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
       :::::::::::::::::  :::::::::::: :::::::::::::.:.::::::.:::::
NP_002 SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDD
              130       140       150       160       170       180

              190       200       210       
pF1KB6 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
       :::::::::::::::::::::::::::::::::::::
NP_002 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
              190       200       210       

>>NP_066271 (OMIM: 118820) chorionic somatomammotropin h  (217 aa)
 initn: 1229 init1: 1229 opt: 1229  Z-score: 1562.8  bits: 296.3 E(85289): 2.6e-80
Smith-Waterman score: 1229; 85.3% identity (95.4% similar) in 217 aa overlap (1-217:1-217)

               10        20        30        40        50        60
pF1KB6 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
       ::.::::::::::.:::::::::..:  :.:::::::.:::.::: ::::.::::::::.
NP_066 MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
               10        20        30        40        50        60

               70        80        90       100       110       120
pF1KB6 YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
       ::::.::::::.. :::.:::.::::::: :::::::::::::::::::.::::::.:::
NP_066 YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
               70        80        90       100       110       120

              130       140       150       160       170       180
pF1KB6 SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
       :.:::.::: .:::. : :::::::::::::::::::: :::::.::::::::::::: :
NP_066 SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
              130       140       150       160       170       180

              190       200       210       
pF1KB6 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
       ::::::::::::::::::::::::.::::::::::::
NP_066 ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
              190       200       210       

>>NP_001308 (OMIM: 150200) chorionic somatomammotropin h  (217 aa)
 initn: 1228 init1: 1228 opt: 1228  Z-score: 1561.5  bits: 296.0 E(85289): 3.1e-80
Smith-Waterman score: 1228; 85.3% identity (94.9% similar) in 217 aa overlap (1-217:1-217)

               10        20        30        40        50        60
pF1KB6 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
       :: ::::::::::.:::::::::..:  :.:::::::.:::.::: ::::.::::::::.
NP_001 MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
               10        20        30        40        50        60

               70        80        90       100       110       120
pF1KB6 YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
       ::::.::::::.. :::.:::.::::::: :::::::::::::::::::.::::::.:::
NP_001 YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
               70        80        90       100       110       120

              130       140       150       160       170       180
pF1KB6 SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
       :.:::.::: .:::. : :::::::::::::::::::: :::::.::::::::::::: :
NP_001 SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
              130       140       150       160       170       180

              190       200       210       
pF1KB6 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
       ::::::::::::::::::::::::.::::::::::::
NP_001 ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
              190       200       210       

>>NP_072101 (OMIM: 603515) chorionic somatomammotropin h  (222 aa)
 initn: 1128 init1: 843 opt: 1120  Z-score: 1424.5  bits: 270.7 E(85289): 1.3e-72
Smith-Waterman score: 1120; 79.3% identity (89.6% similar) in 222 aa overlap (1-217:1-222)

               10        20        30        40        50          
pF1KB6 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEF---
       ::.::::::::::.:::::::::..:  :.:::::: .:::.::: ::::.::::::   
NP_072 MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISS
               10        20        30        40        50        60

          60        70        80        90       100       110     
pF1KB6 --EEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEP
          :::: ::::::::.. :::.:::.:::: :: ::::::::::::.::::::.: :::
NP_072 WGMEAYITKEQKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEP
               70        80        90       100       110       120

         120       130       140       150       160       170     
pF1KB6 VQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTN
       :.::::.:.:.::: .:::. : :::::::::: :::::::::  ::: .::::::::::
NP_072 VRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTN
              130       140       150       160       170       180

         180       190       200       210       
pF1KB6 SHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
       ::: ::::::::::.::::::::::::::.::::::::::::
NP_072 SHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF
              190       200       210       220  

>>NP_072053 (OMIM: 139250,173100,262400,262650,612781) s  (202 aa)
 initn: 1327 init1: 958 opt: 958  Z-score: 1219.8  bits: 232.7 E(85289): 3.3e-61
Smith-Waterman score: 1301; 93.1% identity (93.1% similar) in 217 aa overlap (1-217:1-202)

               10        20        30        40        50        60
pF1KB6 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::::   
NP_072 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEF---
               10        20        30        40        50          

               70        80        90       100       110       120
pF1KB6 YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
                   ::::::::::::::::::::::::::::::::::::::::::::::::
NP_072 ------------NPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
                    60        70        80        90       100     

              130       140       150       160       170       180
pF1KB6 SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_072 SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
         110       120       130       140       150       160     

              190       200       210       
pF1KB6 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
       :::::::::::::::::::::::::::::::::::::
NP_072 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
         170       180       190       200  

>>NP_072051 (OMIM: 139240) growth hormone variant isofor  (256 aa)
 initn: 892 init1: 892 opt: 904  Z-score: 1150.0  bits: 220.1 E(85289): 2.6e-57
Smith-Waterman score: 904; 88.3% identity (92.6% similar) in 163 aa overlap (1-162:1-163)

               10        20        30        40        50        60
pF1KB6 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
       ::.::::::::::::::: ::::::::::::::::::::::::.::.:::.:::::::::
NP_072 MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEA
               10        20        30        40        50        60

               70        80        90       100       110       120
pF1KB6 YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
       :: ::::::::::::::::::::::::::: .:::::::::::::::::::::::::.::
NP_072 YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
               70        80        90       100       110       120

              130       140       150        160       170         
pF1KB6 SVFANSLVYGASDSNVYDLLKDLEEGIQTLMG-RLEDGSPRTGQIFKQTYSKFDTNSHND
       :::::::::::::::::  ::::::::::::  :.  : :  :                 
NP_072 SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWVRVAPGIPNPGAPLASRDWGEKHCCPLF
              130       140       150       160       170       180

     180       190       200       210                             
pF1KB6 DALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF                      
                                                                   
NP_072 SSQALTQENSPYSSFPLVNPPGLSLQPGGEGGKWMNERGREQCPSAWPLLLFLHFAEAGR
              190       200       210       220       230       240

>>NP_072052 (OMIM: 139240) growth hormone variant isofor  (245 aa)
 initn: 931 init1: 895 opt: 895  Z-score: 1138.9  bits: 218.0 E(85289): 1.1e-56
Smith-Waterman score: 895; 92.1% identity (96.7% similar) in 152 aa overlap (1-152:1-152)

               10        20        30        40        50        60
pF1KB6 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
       ::.::::::::::::::: ::::::::::::::::::::::::.::.:::.:::::::::
NP_072 MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEA
               10        20        30        40        50        60

               70        80        90       100       110       120
pF1KB6 YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
       :: ::::::::::::::::::::::::::: .:::::::::::::::::::::::::.::
NP_072 YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
               70        80        90       100       110       120

              130       140       150       160       170       180
pF1KB6 SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
       :::::::::::::::::  :::::::::::.:                            
NP_072 SVFANSLVYGASDSNVYRHLKDLEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTH
              130       140       150       160       170       180

              190       200       210                              
pF1KB6 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF                       
                                                                   
NP_072 CSRTTGCSTASGRTWTRSRHSCASCSAALWRAAVASSCPGGIPVTPPQCLSWSWKVLLQC
              190       200       210       220       230       240

>>NP_072050 (OMIM: 139240) growth hormone variant isofor  (202 aa)
 initn: 1223 init1: 892 opt: 892  Z-score: 1136.2  bits: 217.2 E(85289): 1.5e-56
Smith-Waterman score: 1197; 86.6% identity (90.8% similar) in 217 aa overlap (1-217:1-202)

               10        20        30        40        50        60
pF1KB6 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
       ::.::::::::::::::: ::::::::::::::::::::::::.::.:::.::::::   
NP_072 MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEF---
               10        20        30        40        50          

               70        80        90       100       110       120
pF1KB6 YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
                   :::::::::::::::::: .:::::::::::::::::::::::::.::
NP_072 ------------NPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
                    60        70        80        90       100     

              130       140       150       160       170       180
pF1KB6 SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
       :::::::::::::::::  :::::::::::: :::::::::::::.:.::::::.:::::
NP_072 SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDD
         110       120       130       140       150       160     

              190       200       210       
pF1KB6 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
       :::::::::::::::::::::::::::::::::::::
NP_072 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
         170       180       190       200  

>>NP_001307998 (OMIM: 603515) chorionic somatomammotropi  (183 aa)
 initn: 849 init1: 849 opt: 850  Z-score: 1083.6  bits: 207.4 E(85289): 1.3e-53
Smith-Waterman score: 912; 70.5% identity (78.3% similar) in 217 aa overlap (1-217:1-183)

               10        20        30        40        50        60
pF1KB6 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
       ::.::::::::::.:::::::::                                  :::
NP_001 MAAGSRTSLLLAFALLCLPWLQE----------------------------------EEA
               10        20                                        

               70        80        90       100       110       120
pF1KB6 YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
       :: ::::::::.. :::.:::.:::: :: ::::::::::::.::::::.: ::::.:::
NP_001 YITKEQKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEPVRFLR
         30        40        50        60        70        80      

              130       140       150       160       170       180
pF1KB6 SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
       :.:.:.::: .:::. : :::::::::: :::::::::  ::: .::::::::::::: :
NP_001 STFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTNSHNHD
         90       100       110       120       130       140      

              190       200       210       
pF1KB6 ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
       :::::::::.::::::::::::::.::::::::::::
NP_001 ALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF
        150       160       170       180   




217 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 09:47:57 2016 done: Sun Nov  6 09:47:58 2016
 Total Scan time:  6.250 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com