FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5178, 153 aa 1>>>pF1KE5178 153 - 153 aa - 153 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.3032+/-0.000626; mu= 12.0768+/- 0.038 mean_var=60.7754+/-12.175, 0's: 0 Z-trim(111.6): 7 B-trim: 393 in 1/50 Lambda= 0.164517 statistics sampled from 12484 (12487) to 12484 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.764), E-opt: 0.2 (0.384), width: 16 Scan time: 1.840 The best scores are: opt bits E(32554) CCDS31336.1 MRPL23 gene_id:6150|Hs108|chr11 ( 153) 1042 254.8 1.5e-68 >>CCDS31336.1 MRPL23 gene_id:6150|Hs108|chr11 (153 aa) initn: 1042 init1: 1042 opt: 1042 Z-score: 1344.4 bits: 254.8 E(32554): 1.5e-68 Smith-Waterman score: 1042; 100.0% identity (100.0% similar) in 153 aa overlap (1-153:1-153) 10 20 30 40 50 60 pF1KE5 MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS31 MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGI 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 YNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS31 YNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEG 70 80 90 100 110 120 130 140 150 pF1KE5 SAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL ::::::::::::::::::::::::::::::::: CCDS31 SAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL 130 140 150 153 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:19:30 2016 done: Mon Nov 7 22:19:31 2016 Total Scan time: 1.840 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]