FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6177, 108 aa 1>>>pF1KE6177 108 - 108 aa - 108 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.9272+/-0.000323; mu= 12.2781+/- 0.020 mean_var=62.9978+/-12.582, 0's: 0 Z-trim(116.4): 26 B-trim: 352 in 1/50 Lambda= 0.161589 statistics sampled from 27452 (27471) to 27452 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.719), E-opt: 0.2 (0.322), width: 16 Scan time: 3.080 The best scores are: opt bits E(85289) NP_001003696 (OMIM: 603152) ATP synthase-coupling ( 108) 696 170.0 6.7e-43 NP_001676 (OMIM: 603152) ATP synthase-coupling fac ( 108) 696 170.0 6.7e-43 NP_001003703 (OMIM: 603152) ATP synthase-coupling ( 108) 696 170.0 6.7e-43 NP_001307195 (OMIM: 603152) ATP synthase-coupling ( 108) 696 170.0 6.7e-43 NP_001307196 (OMIM: 603152) ATP synthase-coupling ( 108) 696 170.0 6.7e-43 NP_001003697 (OMIM: 603152) ATP synthase-coupling ( 108) 696 170.0 6.7e-43 NP_001003701 (OMIM: 603152) ATP synthase-coupling ( 116) 696 170.0 7.1e-43 >>NP_001003696 (OMIM: 603152) ATP synthase-coupling fact (108 aa) initn: 696 init1: 696 opt: 696 Z-score: 891.2 bits: 170.0 E(85289): 6.7e-43 Smith-Waterman score: 696; 100.0% identity (100.0% similar) in 108 aa overlap (1-108:1-108) 10 20 30 40 50 60 pF1KE6 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP 10 20 30 40 50 60 70 80 90 100 pF1KE6 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA :::::::::::::::::::::::::::::::::::::::::::::::: NP_001 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA 70 80 90 100 >>NP_001676 (OMIM: 603152) ATP synthase-coupling factor (108 aa) initn: 696 init1: 696 opt: 696 Z-score: 891.2 bits: 170.0 E(85289): 6.7e-43 Smith-Waterman score: 696; 100.0% identity (100.0% similar) in 108 aa overlap (1-108:1-108) 10 20 30 40 50 60 pF1KE6 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP 10 20 30 40 50 60 70 80 90 100 pF1KE6 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA :::::::::::::::::::::::::::::::::::::::::::::::: NP_001 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA 70 80 90 100 >>NP_001003703 (OMIM: 603152) ATP synthase-coupling fact (108 aa) initn: 696 init1: 696 opt: 696 Z-score: 891.2 bits: 170.0 E(85289): 6.7e-43 Smith-Waterman score: 696; 100.0% identity (100.0% similar) in 108 aa overlap (1-108:1-108) 10 20 30 40 50 60 pF1KE6 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP 10 20 30 40 50 60 70 80 90 100 pF1KE6 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA :::::::::::::::::::::::::::::::::::::::::::::::: NP_001 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA 70 80 90 100 >>NP_001307195 (OMIM: 603152) ATP synthase-coupling fact (108 aa) initn: 696 init1: 696 opt: 696 Z-score: 891.2 bits: 170.0 E(85289): 6.7e-43 Smith-Waterman score: 696; 100.0% identity (100.0% similar) in 108 aa overlap (1-108:1-108) 10 20 30 40 50 60 pF1KE6 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP 10 20 30 40 50 60 70 80 90 100 pF1KE6 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA :::::::::::::::::::::::::::::::::::::::::::::::: NP_001 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA 70 80 90 100 >>NP_001307196 (OMIM: 603152) ATP synthase-coupling fact (108 aa) initn: 696 init1: 696 opt: 696 Z-score: 891.2 bits: 170.0 E(85289): 6.7e-43 Smith-Waterman score: 696; 100.0% identity (100.0% similar) in 108 aa overlap (1-108:1-108) 10 20 30 40 50 60 pF1KE6 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP 10 20 30 40 50 60 70 80 90 100 pF1KE6 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA :::::::::::::::::::::::::::::::::::::::::::::::: NP_001 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA 70 80 90 100 >>NP_001003697 (OMIM: 603152) ATP synthase-coupling fact (108 aa) initn: 696 init1: 696 opt: 696 Z-score: 891.2 bits: 170.0 E(85289): 6.7e-43 Smith-Waterman score: 696; 100.0% identity (100.0% similar) in 108 aa overlap (1-108:1-108) 10 20 30 40 50 60 pF1KE6 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP 10 20 30 40 50 60 70 80 90 100 pF1KE6 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA :::::::::::::::::::::::::::::::::::::::::::::::: NP_001 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA 70 80 90 100 >>NP_001003701 (OMIM: 603152) ATP synthase-coupling fact (116 aa) initn: 696 init1: 696 opt: 696 Z-score: 890.7 bits: 170.0 E(85289): 7.1e-43 Smith-Waterman score: 696; 100.0% identity (100.0% similar) in 108 aa overlap (1-108:9-116) 10 20 30 40 50 pF1KE6 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKS :::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MHCDGGISMILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKS 10 20 30 40 50 60 60 70 80 90 100 pF1KE6 KRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA :::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 KRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA 70 80 90 100 110 108 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 10:06:43 2016 done: Tue Nov 8 10:06:43 2016 Total Scan time: 3.080 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]