FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3801, 69 aa 1>>>pF1KE3801 69 - 69 aa - 69 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8725+/-0.000508; mu= 9.9684+/- 0.031 mean_var=61.0519+/-11.988, 0's: 0 Z-trim(114.0): 12 B-trim: 0 in 0/53 Lambda= 0.164144 statistics sampled from 14543 (14555) to 14543 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.831), E-opt: 0.2 (0.447), width: 16 Scan time: 1.340 The best scores are: opt bits E(32554) CCDS11545.1 GNGT2 gene_id:2793|Hs108|chr17 ( 69) 448 113.1 1.4e-26 CCDS5634.1 GNG11 gene_id:2791|Hs108|chr7 ( 73) 299 77.8 6.3e-16 CCDS5633.1 GNGT1 gene_id:2792|Hs108|chr7 ( 74) 294 76.6 1.4e-15 >>CCDS11545.1 GNGT2 gene_id:2793|Hs108|chr17 (69 aa) initn: 448 init1: 448 opt: 448 Z-score: 590.5 bits: 113.1 E(32554): 1.4e-26 Smith-Waterman score: 448; 100.0% identity (100.0% similar) in 69 aa overlap (1-69:1-69) 10 20 30 40 50 60 pF1KE3 MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPF :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS11 MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPF 10 20 30 40 50 60 pF1KE3 KEKGGCLIS ::::::::: CCDS11 KEKGGCLIS >>CCDS5634.1 GNG11 gene_id:2791|Hs108|chr7 (73 aa) initn: 299 init1: 299 opt: 299 Z-score: 399.4 bits: 77.8 E(32554): 6.3e-16 Smith-Waterman score: 299; 65.7% identity (88.1% similar) in 67 aa overlap (3-69:7-73) 10 20 30 40 50 pF1KE3 MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPED .:: ::. ::::::::.:::: : .:: ..:::.:.: ..:.::..:::::: CCDS56 MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED 10 20 30 40 50 60 60 pF1KE3 KNPFKEKGGCLIS ::::::::.:.:: CCDS56 KNPFKEKGSCVIS 70 >>CCDS5633.1 GNGT1 gene_id:2792|Hs108|chr7 (74 aa) initn: 292 init1: 260 opt: 294 Z-score: 392.9 bits: 76.6 E(32554): 1.4e-15 Smith-Waterman score: 294; 64.7% identity (86.8% similar) in 68 aa overlap (3-69:7-74) 10 20 30 40 50 pF1KE3 MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPED .::.::: :::::.:::::: :. .:: .:...::: ..:.::..:::::: CCDS56 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED 10 20 30 40 50 60 60 pF1KE3 KNPFKE-KGGCLIS :::::: ::::.:: CCDS56 KNPFKELKGGCVIS 70 69 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 06:38:40 2016 done: Sun Nov 6 06:38:41 2016 Total Scan time: 1.340 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]