FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6594, 72 aa 1>>>pF1KE6594 72 - 72 aa - 72 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.9698+/-0.000412; mu= 9.6963+/- 0.025 mean_var=57.9722+/-11.622, 0's: 0 Z-trim(117.5): 2 B-trim: 98 in 1/50 Lambda= 0.168447 statistics sampled from 18283 (18285) to 18283 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.885), E-opt: 0.2 (0.562), width: 16 Scan time: 1.160 The best scores are: opt bits E(32554) CCDS9910.1 COX8C gene_id:341947|Hs108|chr14 ( 72) 492 126.0 1.9e-30 >>CCDS9910.1 COX8C gene_id:341947|Hs108|chr14 (72 aa) initn: 492 init1: 492 opt: 492 Z-score: 660.0 bits: 126.0 E(32554): 1.9e-30 Smith-Waterman score: 492; 100.0% identity (100.0% similar) in 72 aa overlap (1-72:1-72) 10 20 30 40 50 60 pF1KE6 MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS99 MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAA 10 20 30 40 50 60 70 pF1KE6 YVLGNLKQFRRN :::::::::::: CCDS99 YVLGNLKQFRRN 70 72 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:39:36 2016 done: Tue Nov 8 14:39:36 2016 Total Scan time: 1.160 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]