FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5183, 115 aa
  1>>>pF1KE5183 115 - 115 aa - 115 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.9466+/-0.000559; mu= 10.0262+/- 0.034
 mean_var=96.3066+/-19.074, 0's: 0 Z-trim(116.1): 5  B-trim: 0 in 0/51
 Lambda= 0.130691
 statistics sampled from 16715 (16719) to 16715 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.824), E-opt: 0.2 (0.514), width:  16
 Scan time:  1.870

The best scores are:                                      opt bits E(32554)
CCDS7717.1 RPLP2 gene_id:6181|Hs108|chr11          ( 115)  719 143.8 2.2e-35


>>CCDS7717.1 RPLP2 gene_id:6181|Hs108|chr11               (115 aa)
 initn: 719 init1: 719 opt: 719  Z-score: 748.9  bits: 143.8 E(32554): 2.2e-35
Smith-Waterman score: 719; 100.0% identity (100.0% similar) in 115 aa overlap (1-115:1-115)

               10        20        30        40        50        60
pF1KE5 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIG
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS77 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIG
               10        20        30        40        50        60

               70        80        90       100       110     
pF1KE5 KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS77 KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
               70        80        90       100       110     




115 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 22:22:23 2016 done: Mon Nov  7 22:22:23 2016
 Total Scan time:  1.870 Total Display time: -0.050

Function used was FASTA [36.3.4 Apr, 2011]