FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5147, 70 aa 1>>>pF1KE5147 70 - 70 aa - 70 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.2957+/-0.00024; mu= 7.2465+/- 0.015 mean_var=69.3526+/-13.651, 0's: 0 Z-trim(122.4): 20 B-trim: 99 in 1/56 Lambda= 0.154008 statistics sampled from 40398 (40421) to 40398 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.831), E-opt: 0.2 (0.474), width: 16 Scan time: 3.540 The best scores are: opt bits E(85289) NP_006295 (OMIM: 601285) 26S proteasome complex su ( 70) 494 117.3 2e-27 >>NP_006295 (OMIM: 601285) 26S proteasome complex subuni (70 aa) initn: 494 init1: 494 opt: 494 Z-score: 613.3 bits: 117.3 E(85289): 2e-27 Smith-Waterman score: 494; 100.0% identity (100.0% similar) in 70 aa overlap (1-70:1-70) 10 20 30 40 50 60 pF1KE5 MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_006 MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL 10 20 30 40 50 60 70 pF1KE5 EKHGYKMETS :::::::::: NP_006 EKHGYKMETS 70 70 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:58:37 2016 done: Mon Nov 7 21:58:38 2016 Total Scan time: 3.540 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]