FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5147, 70 aa 1>>>pF1KE5147 70 - 70 aa - 70 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.4449+/-0.000494; mu= 6.3622+/- 0.030 mean_var=67.3071+/-13.424, 0's: 0 Z-trim(114.9): 7 B-trim: 0 in 0/52 Lambda= 0.156331 statistics sampled from 15483 (15490) to 15483 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.832), E-opt: 0.2 (0.476), width: 16 Scan time: 1.130 The best scores are: opt bits E(32554) CCDS5646.1 SHFM1 gene_id:7979|Hs108|chr7 ( 70) 494 118.9 2.5e-28 >>CCDS5646.1 SHFM1 gene_id:7979|Hs108|chr7 (70 aa) initn: 494 init1: 494 opt: 494 Z-score: 622.0 bits: 118.9 E(32554): 2.5e-28 Smith-Waterman score: 494; 100.0% identity (100.0% similar) in 70 aa overlap (1-70:1-70) 10 20 30 40 50 60 pF1KE5 MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS56 MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL 10 20 30 40 50 60 70 pF1KE5 EKHGYKMETS :::::::::: CCDS56 EKHGYKMETS 70 70 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:58:37 2016 done: Mon Nov 7 21:58:37 2016 Total Scan time: 1.130 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]