FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5185, 130 aa 1>>>pF1KE5185 130 - 130 aa - 130 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.7824+/-0.000347; mu= 13.0337+/- 0.022 mean_var=51.3167+/- 9.950, 0's: 0 Z-trim(113.5): 5 B-trim: 445 in 1/55 Lambda= 0.179038 statistics sampled from 22848 (22851) to 22848 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.666), E-opt: 0.2 (0.268), width: 16 Scan time: 4.720 The best scores are: opt bits E(85289) NP_057053 (OMIM: 611980) 28S ribosomal protein S17 ( 130) 830 221.8 2.5e-58 >>NP_057053 (OMIM: 611980) 28S ribosomal protein S17, mi (130 aa) initn: 830 init1: 830 opt: 830 Z-score: 1168.2 bits: 221.8 E(85289): 2.5e-58 Smith-Waterman score: 830; 100.0% identity (100.0% similar) in 130 aa overlap (1-130:1-130) 10 20 30 40 50 60 pF1KE5 MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_057 MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTV 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 GDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_057 GDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKN 70 80 90 100 110 120 130 pF1KE5 LEELNISSAQ :::::::::: NP_057 LEELNISSAQ 130 130 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:23:21 2016 done: Mon Nov 7 22:23:22 2016 Total Scan time: 4.720 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]