FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1662, 180 aa 1>>>pF1KE1662 180 - 180 aa - 180 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.6626+/-0.000527; mu= 13.3892+/- 0.032 mean_var=89.3283+/-17.358, 0's: 0 Z-trim(116.9): 9 B-trim: 0 in 0/52 Lambda= 0.135700 statistics sampled from 17618 (17625) to 17618 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.849), E-opt: 0.2 (0.541), width: 16 Scan time: 2.310 The best scores are: opt bits E(32554) CCDS4297.1 IL17B gene_id:27190|Hs108|chr5 ( 180) 1283 259.5 8e-70 >>CCDS4297.1 IL17B gene_id:27190|Hs108|chr5 (180 aa) initn: 1283 init1: 1283 opt: 1283 Z-score: 1367.0 bits: 259.5 E(32554): 8e-70 Smith-Waterman score: 1283; 100.0% identity (100.0% similar) in 180 aa overlap (1-180:1-180) 10 20 30 40 50 60 pF1KE1 MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARME :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS42 MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARME 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 EYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEAR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS42 EYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEAR 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE1 CLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS42 CLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF 130 140 150 160 170 180 180 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 17:04:55 2016 done: Sun Nov 6 17:04:55 2016 Total Scan time: 2.310 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]