FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2147, 124 aa 1>>>pF1KE2147 124 - 124 aa - 124 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8489+/-0.000289; mu= 12.9362+/- 0.018 mean_var=61.4394+/-12.968, 0's: 0 Z-trim(117.7): 15 B-trim: 1403 in 1/57 Lambda= 0.163625 statistics sampled from 30003 (30017) to 30003 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.737), E-opt: 0.2 (0.352), width: 16 Scan time: 4.720 The best scores are: opt bits E(85289) NP_004544 (OMIM: 252010,603848) NADH dehydrogenase ( 124) 858 210.2 6.9e-55 >>NP_004544 (OMIM: 252010,603848) NADH dehydrogenase [ub (124 aa) initn: 858 init1: 858 opt: 858 Z-score: 1106.4 bits: 210.2 E(85289): 6.9e-55 Smith-Waterman score: 858; 100.0% identity (100.0% similar) in 124 aa overlap (1-124:1-124) 10 20 30 40 50 60 pF1KE2 MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQ 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE2 KEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 KEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFR 70 80 90 100 110 120 pF1KE2 QHHH :::: NP_004 QHHH 124 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 15:54:24 2016 done: Mon Nov 7 15:54:24 2016 Total Scan time: 4.720 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]