FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3871, 132 aa 1>>>pF1KE3871 132 - 132 aa - 132 aa Library: human.CCDS.faa 18921897 residues in 33420 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.3256+/-0.000589; mu= 12.0305+/- 0.036 mean_var=76.1779+/-14.871, 0's: 0 Z-trim(113.3): 9 B-trim: 0 in 0/51 Lambda= 0.146947 statistics sampled from 14144 (14147) to 14144 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.794), E-opt: 0.2 (0.423), width: 16 Scan time: 0.850 The best scores are: opt bits E(33420) CCDS3695.1 FAM241A gene_id:132720|Hs109|chr4 ( 132) 875 193.6 3.1e-50 >>CCDS3695.1 FAM241A gene_id:132720|Hs109|chr4 (132 aa) initn: 875 init1: 875 opt: 875 Z-score: 1015.6 bits: 193.6 E(33420): 3.1e-50 Smith-Waterman score: 875; 97.7% identity (97.7% similar) in 132 aa overlap (1-132:1-132) 10 20 30 40 50 60 pF1KE3 MCSAGELLRGGDGGERDEDGDALAEREAAGTEWDPGASQRRRGQRQKESEQDVEDSQNHT ::::::::::::::::::::::::::::::: :::::: :::::: :::::::::::::: CCDS36 MCSAGELLRGGDGGERDEDGDALAEREAAGTGWDPGASPRRRGQRPKESEQDVEDSQNHT 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 GEPVGDDYKKMGTLFGELNKNLINMGFTRMYFGERIVEPVIVIFFWVMLWFLGLQALGLV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS36 GEPVGDDYKKMGTLFGELNKNLINMGFTRMYFGERIVEPVIVIFFWVMLWFLGLQALGLV 70 80 90 100 110 120 130 pF1KE3 AVLCLVIIYVQQ :::::::::::: CCDS36 AVLCLVIIYVQQ 130 132 residues in 1 query sequences 18921897 residues in 33420 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Wed Aug 4 20:33:17 2021 done: Wed Aug 4 20:33:17 2021 Total Scan time: 0.850 Total Display time: 0.010 Function used was FASTA [36.3.4 Apr, 2011]