FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5149, 92 aa 1>>>pF1KE5149 92 - 92 aa - 92 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.9512+/-0.000693; mu= 5.5481+/- 0.041 mean_var=64.6640+/-13.539, 0's: 0 Z-trim(109.5): 6 B-trim: 2 in 1/50 Lambda= 0.159493 statistics sampled from 10908 (10909) to 10908 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.721), E-opt: 0.2 (0.335), width: 16 Scan time: 1.250 The best scores are: opt bits E(32554) CCDS2404.1 RPL37A gene_id:6168|Hs108|chr2 ( 92) 612 148.8 4.4e-37 >>CCDS2404.1 RPL37A gene_id:6168|Hs108|chr2 (92 aa) initn: 612 init1: 612 opt: 612 Z-score: 779.2 bits: 148.8 E(32554): 4.4e-37 Smith-Waterman score: 612; 100.0% identity (100.0% similar) in 92 aa overlap (1-92:1-92) 10 20 30 40 50 60 pF1KE5 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS24 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC 10 20 30 40 50 60 70 80 90 pF1KE5 MKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ :::::::::::::::::::::::::::::::: CCDS24 MKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ 70 80 90 92 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 07:21:09 2016 done: Tue Nov 8 07:21:09 2016 Total Scan time: 1.250 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]