FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1608, 114 aa 1>>>pF1KE1608 114 - 114 aa - 114 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.2999+/-0.000646; mu= 11.2104+/- 0.039 mean_var=72.6378+/-14.257, 0's: 0 Z-trim(111.6): 33 B-trim: 85 in 1/51 Lambda= 0.150485 statistics sampled from 12499 (12531) to 12499 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.766), E-opt: 0.2 (0.385), width: 16 Scan time: 1.590 The best scores are: opt bits E(32554) CCDS1036.1 S100A9 gene_id:6280|Hs108|chr1 ( 114) 775 176.2 3.7e-45 CCDS1037.1 S100A12 gene_id:6283|Hs108|chr1 ( 92) 274 67.4 1.7e-12 >>CCDS1036.1 S100A9 gene_id:6280|Hs108|chr1 (114 aa) initn: 775 init1: 775 opt: 775 Z-score: 924.2 bits: 176.2 E(32554): 3.7e-45 Smith-Waterman score: 775; 100.0% identity (100.0% similar) in 114 aa overlap (1-114:1-114) 10 20 30 40 50 60 pF1KE1 MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE 10 20 30 40 50 60 70 80 90 100 110 pF1KE1 HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP :::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP 70 80 90 100 110 >>CCDS1037.1 S100A12 gene_id:6283|Hs108|chr1 (92 aa) initn: 252 init1: 164 opt: 274 Z-score: 337.7 bits: 67.4 E(32554): 1.7e-12 Smith-Waterman score: 274; 46.7% identity (79.3% similar) in 92 aa overlap (5-96:1-91) 10 20 30 40 50 60 pF1KE1 MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE :..::...: :.: ::::::. :: :::..::.:.:. :.: : .:. :.. ::. CCDS10 MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKN-IKDKAVID 10 20 30 40 50 70 80 90 100 110 pF1KE1 HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP .:.. ::.: :.:..:.::: :.: :.: . :. CCDS10 EIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE 60 70 80 90 114 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 18:54:39 2016 done: Sun Nov 6 18:54:39 2016 Total Scan time: 1.590 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]