FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6593, 51 aa
  1>>>pF1KE6593 51 - 51 aa - 51 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 3.8837+/-0.000557; mu= 11.0532+/- 0.033
 mean_var=35.0569+/- 7.007, 0's: 0 Z-trim(109.9): 4  B-trim: 70 in 1/49
 Lambda= 0.216614
 statistics sampled from 11204 (11206) to 11204 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.772), E-opt: 0.2 (0.344), width:  16
 Scan time:  0.970

The best scores are:                                      opt bits E(32554)
CCDS13476.1 ATP5E gene_id:514|Hs108|chr20          (  51)  321 105.8 1.2e-24


>>CCDS13476.1 ATP5E gene_id:514|Hs108|chr20               (51 aa)
 initn: 321 init1: 321 opt: 321  Z-score: 556.0  bits: 105.8 E(32554): 1.2e-24
Smith-Waterman score: 321; 100.0% identity (100.0% similar) in 51 aa overlap (1-51:1-51)

               10        20        30        40        50 
pF1KE6 MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
       :::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS13 MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
               10        20        30        40        50 




51 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:39:12 2016 done: Tue Nov  8 14:39:13 2016
 Total Scan time:  0.970 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]