FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6131, 63 aa 1>>>pF1KE6131 63 - 63 aa - 63 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8505+/-0.00045; mu= 7.5476+/- 0.027 mean_var=41.8606+/- 8.653, 0's: 0 Z-trim(113.6): 8 B-trim: 0 in 0/50 Lambda= 0.198231 statistics sampled from 14203 (14206) to 14203 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.834), E-opt: 0.2 (0.436), width: 16 Scan time: 0.990 The best scores are: opt bits E(32554) CCDS4063.1 COX7C gene_id:1350|Hs108|chr5 ( 63) 420 126.2 1.3e-30 >>CCDS4063.1 COX7C gene_id:1350|Hs108|chr5 (63 aa) initn: 420 init1: 420 opt: 420 Z-score: 662.9 bits: 126.2 E(32554): 1.3e-30 Smith-Waterman score: 420; 100.0% identity (100.0% similar) in 63 aa overlap (1-63:1-63) 10 20 30 40 50 60 pF1KE6 MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS40 MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL 10 20 30 40 50 60 pF1KE6 LKT ::: CCDS40 LKT 63 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:43:41 2016 done: Tue Nov 8 09:43:42 2016 Total Scan time: 0.990 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]