FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3403, 170 aa 1>>>pF1KE3403 170 - 170 aa - 170 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.5355+/-0.000276; mu= 16.3603+/- 0.017 mean_var=60.1661+/-11.879, 0's: 0 Z-trim(118.8): 94 B-trim: 22 in 1/53 Lambda= 0.165348 statistics sampled from 32062 (32164) to 32062 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.772), E-opt: 0.2 (0.377), width: 16 Scan time: 4.930 The best scores are: opt bits E(85289) NP_068823 (OMIM: 602995) ubiquitin-conjugating enz ( 170) 1160 284.3 6.4e-77 NP_001244322 (OMIM: 602995) ubiquitin-conjugating ( 170) 1160 284.3 6.4e-77 NP_954595 (OMIM: 602995) ubiquitin-conjugating enz ( 170) 1160 284.3 6.4e-77 NP_001027459 (OMIM: 602995) ubiquitin-conjugating ( 147) 955 235.4 3e-62 NP_001244324 (OMIM: 602995) ubiquitin-conjugating ( 144) 936 230.8 6.9e-61 XP_011515885 (OMIM: 603001) PREDICTED: ubiquitin-c ( 173) 882 218.0 5.9e-57 NP_003341 (OMIM: 603001) ubiquitin-conjugating enz ( 145) 881 217.7 6.1e-57 XP_016869297 (OMIM: 603001) PREDICTED: ubiquitin-c ( 142) 873 215.8 2.3e-56 NP_001244327 (OMIM: 602995) ubiquitin-conjugating ( 105) 716 178.2 3.4e-45 NP_001269508 (OMIM: 602995) ubiquitin-conjugating ( 105) 716 178.2 3.4e-45 NP_001269505 (OMIM: 602995) ubiquitin-conjugating ( 105) 716 178.2 3.4e-45 NP_001244326 (OMIM: 602995) ubiquitin-conjugating ( 105) 716 178.2 3.4e-45 NP_001244328 (OMIM: 602995) ubiquitin-conjugating ( 105) 716 178.2 3.4e-45 XP_005251357 (OMIM: 603001) PREDICTED: ubiquitin-c ( 105) 642 160.6 7e-40 NP_071887 (OMIM: 602995) ubiquitin-conjugating enz ( 103) 614 153.9 7.1e-38 NP_001244323 (OMIM: 602995) ubiquitin-conjugating ( 103) 614 153.9 7.1e-38 NP_001269506 (OMIM: 602995) ubiquitin-conjugating ( 91) 607 152.2 2.1e-37 NP_001269504 (OMIM: 602995) ubiquitin-conjugating ( 91) 607 152.2 2.1e-37 NP_001269507 (OMIM: 602995) ubiquitin-conjugating ( 91) 607 152.2 2.1e-37 NP_001269509 (OMIM: 602995) ubiquitin-conjugating ( 64) 348 90.3 6.3e-19 NP_001244325 (OMIM: 602995) ubiquitin-conjugating ( 105) 348 90.4 9.1e-19 NP_001104582 (OMIM: 602846) ubiquitin-conjugating ( 157) 191 53.1 2.3e-07 NP_005330 (OMIM: 602846) ubiquitin-conjugating enz ( 200) 191 53.2 2.8e-07 NP_003332 (OMIM: 602916) ubiquitin-conjugating enz ( 193) 174 49.2 4.5e-06 NP_003333 (OMIM: 601569) ubiquitin-conjugating enz ( 170) 167 47.4 1.3e-05 NP_003327 (OMIM: 300860,312180) ubiquitin-conjugat ( 152) 166 47.2 1.4e-05 NP_001189405 (OMIM: 602916) ubiquitin-conjugating ( 160) 164 46.7 2e-05 XP_005265488 (OMIM: 602916) PREDICTED: ubiquitin-c ( 167) 164 46.7 2.1e-05 NP_003328 (OMIM: 179095) ubiquitin-conjugating enz ( 152) 162 46.2 2.7e-05 NP_872607 (OMIM: 602916) ubiquitin-conjugating enz ( 176) 162 46.3 3e-05 XP_005265490 (OMIM: 602163) PREDICTED: ubiquitin-c ( 189) 160 45.8 4.5e-05 XP_005265489 (OMIM: 602163) PREDICTED: ubiquitin-c ( 201) 160 45.8 4.7e-05 NP_689866 (OMIM: 602163) ubiquitin-conjugating enz ( 201) 160 45.8 4.7e-05 NP_003329 (OMIM: 602961) ubiquitin-conjugating enz ( 147) 157 45.0 6.1e-05 NP_008950 (OMIM: 605574) ubiquitin-conjugating enz ( 179) 157 45.1 7e-05 NP_001269090 (OMIM: 300860,312180) ubiquitin-conju ( 119) 155 44.4 7.2e-05 NP_054895 (OMIM: 610538,616435) ubiquitin-conjugat ( 197) 157 45.1 7.6e-05 NP_861517 (OMIM: 605574) ubiquitin-conjugating enz ( 140) 151 43.5 0.00016 NP_004214 (OMIM: 603890) ubiquitin/ISG15-conjugati ( 153) 151 43.6 0.00017 XP_005246301 (OMIM: 604151) PREDICTED: ubiquitin-c ( 207) 149 43.2 0.00029 NP_006348 (OMIM: 604151) ubiquitin-conjugating enz ( 207) 149 43.2 0.00029 NP_872619 (OMIM: 604151) ubiquitin-conjugating enz ( 207) 149 43.2 0.00029 NP_001265483 (OMIM: 604151) ubiquitin-conjugating ( 207) 149 43.2 0.00029 NP_001265484 (OMIM: 604151) ubiquitin-conjugating ( 207) 149 43.2 0.00029 NP_003338 (OMIM: 603721) ubiquitin-conjugating enz ( 154) 141 41.2 0.00088 XP_016864073 (OMIM: 602963) PREDICTED: ubiquitin-c ( 118) 138 40.4 0.0012 NP_001287724 (OMIM: 602963) ubiquitin-conjugating ( 118) 138 40.4 0.0012 NP_862821 (OMIM: 602962) ubiquitin-conjugating enz ( 118) 138 40.4 0.0012 NP_001297255 (OMIM: 610538,616435) ubiquitin-conju ( 167) 139 40.8 0.0013 NP_871618 (OMIM: 602963) ubiquitin-conjugating enz ( 147) 138 40.5 0.0014 >>NP_068823 (OMIM: 602995) ubiquitin-conjugating enzyme (170 aa) initn: 1160 init1: 1160 opt: 1160 Z-score: 1502.0 bits: 284.3 E(85289): 6.4e-77 Smith-Waterman score: 1160; 100.0% identity (100.0% similar) in 170 aa overlap (1-170:1-170) 10 20 30 40 50 60 pF1KE3 MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_068 MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGL 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 EDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_068 EDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSN 70 80 90 100 110 120 130 140 150 160 170 pF1KE3 GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN :::::::::::::::::::::::::::::::::::::::::::::::::: NP_068 GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN 130 140 150 160 170 >>NP_001244322 (OMIM: 602995) ubiquitin-conjugating enzy (170 aa) initn: 1160 init1: 1160 opt: 1160 Z-score: 1502.0 bits: 284.3 E(85289): 6.4e-77 Smith-Waterman score: 1160; 100.0% identity (100.0% similar) in 170 aa overlap (1-170:1-170) 10 20 30 40 50 60 pF1KE3 MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGL 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 EDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 EDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSN 70 80 90 100 110 120 130 140 150 160 170 pF1KE3 GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN :::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN 130 140 150 160 170 >>NP_954595 (OMIM: 602995) ubiquitin-conjugating enzyme (170 aa) initn: 1160 init1: 1160 opt: 1160 Z-score: 1502.0 bits: 284.3 E(85289): 6.4e-77 Smith-Waterman score: 1160; 100.0% identity (100.0% similar) in 170 aa overlap (1-170:1-170) 10 20 30 40 50 60 pF1KE3 MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_954 MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGL 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 EDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_954 EDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSN 70 80 90 100 110 120 130 140 150 160 170 pF1KE3 GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN :::::::::::::::::::::::::::::::::::::::::::::::::: NP_954 GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN 130 140 150 160 170 >>NP_001027459 (OMIM: 602995) ubiquitin-conjugating enzy (147 aa) initn: 955 init1: 955 opt: 955 Z-score: 1238.5 bits: 235.4 E(85289): 3e-62 Smith-Waterman score: 955; 100.0% identity (100.0% similar) in 140 aa overlap (31-170:8-147) 10 20 30 40 50 60 pF1KE3 MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGL :::::::::::::::::::::::::::::: NP_001 MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGL 10 20 30 70 80 90 100 110 120 pF1KE3 EDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 EDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSN 40 50 60 70 80 90 130 140 150 160 170 pF1KE3 GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN :::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN 100 110 120 130 140 >>NP_001244324 (OMIM: 602995) ubiquitin-conjugating enzy (144 aa) initn: 936 init1: 936 opt: 936 Z-score: 1214.2 bits: 230.8 E(85289): 6.9e-61 Smith-Waterman score: 936; 100.0% identity (100.0% similar) in 137 aa overlap (34-170:8-144) 10 20 30 40 50 60 pF1KE3 EVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDD :::::::::::::::::::::::::::::: NP_001 MAATTGSVPRNFRLLEELEEGQKGVGDGTVSWGLEDD 10 20 30 70 80 90 100 110 120 pF1KE3 EDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 EDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVV 40 50 60 70 80 90 130 140 150 160 170 pF1KE3 DPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN ::::::::::::::::::::::::::::::::::::::::::::::: NP_001 DPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN 100 110 120 130 140 >>XP_011515885 (OMIM: 603001) PREDICTED: ubiquitin-conju (173 aa) initn: 910 init1: 881 opt: 882 Z-score: 1143.5 bits: 218.0 E(85289): 5.9e-57 Smith-Waterman score: 882; 90.8% identity (96.5% similar) in 141 aa overlap (30-170:33-173) 10 20 30 40 50 pF1KE3 MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWG .::::::::::::::::::::::::::::: XP_011 VGAHVEEEETAGDKDVEEGVPFPGELVWNREGVKVPRNFRLLEELEEGQKGVGDGTVSWG 10 20 30 40 50 60 60 70 80 90 100 110 pF1KE3 LEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSS :::::::::::::::::::::: :::::::::.::::::::::: :::::::::::.:.: XP_011 LEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNS 70 80 90 100 110 120 120 130 140 150 160 170 pF1KE3 NGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN .:.:: :.: ::::::::::::::::::::::::::::::::::::: :.: XP_011 SGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN 130 140 150 160 170 >>NP_003341 (OMIM: 603001) ubiquitin-conjugating enzyme (145 aa) initn: 906 init1: 881 opt: 881 Z-score: 1143.2 bits: 217.7 E(85289): 6.1e-57 Smith-Waterman score: 881; 91.4% identity (96.4% similar) in 140 aa overlap (31-170:6-145) 10 20 30 40 50 60 pF1KE3 MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGL :::::::::::::::::::::::::::::: NP_003 MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGL 10 20 30 70 80 90 100 110 120 pF1KE3 EDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSN ::::::::::::::::::::: :::::::::.::::::::::: :::::::::::.:.:. NP_003 EDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSS 40 50 60 70 80 90 130 140 150 160 170 pF1KE3 GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN :.:: :.: ::::::::::::::::::::::::::::::::::::: :.: NP_003 GMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN 100 110 120 130 140 >>XP_016869297 (OMIM: 603001) PREDICTED: ubiquitin-conju (142 aa) initn: 885 init1: 873 opt: 873 Z-score: 1133.0 bits: 215.8 E(85289): 2.3e-56 Smith-Waterman score: 873; 91.4% identity (96.4% similar) in 139 aa overlap (32-170:4-142) 10 20 30 40 50 60 pF1KE3 PGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGLE :::::::::::::::::::::::::::::: XP_016 MPRVKVPRNFRLLEELEEGQKGVGDGTVSWGLE 10 20 30 70 80 90 100 110 120 pF1KE3 DDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNG :::::::::::::::::::: :::::::::.::::::::::: :::::::::::.:.:.: XP_016 DDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSG 40 50 60 70 80 90 130 140 150 160 170 pF1KE3 VVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN .:: :.: ::::::::::::::::::::::::::::::::::::: :.: XP_016 MVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN 100 110 120 130 140 >>NP_001244327 (OMIM: 602995) ubiquitin-conjugating enzy (105 aa) initn: 716 init1: 716 opt: 716 Z-score: 932.4 bits: 178.2 E(85289): 3.4e-45 Smith-Waterman score: 716; 100.0% identity (100.0% similar) in 105 aa overlap (66-170:1-105) 40 50 60 70 80 90 pF1KE3 RNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECG :::::::::::::::::::::::::::::: NP_001 MTLTRWTGMIIGPPRTIYENRIYSLKIECG 10 20 30 100 110 120 130 140 150 pF1KE3 PKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 PKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKE 40 50 60 70 80 90 160 170 pF1KE3 NMKLPQPPEGQCYSN ::::::::::::::: NP_001 NMKLPQPPEGQCYSN 100 >>NP_001269508 (OMIM: 602995) ubiquitin-conjugating enzy (105 aa) initn: 716 init1: 716 opt: 716 Z-score: 932.4 bits: 178.2 E(85289): 3.4e-45 Smith-Waterman score: 716; 100.0% identity (100.0% similar) in 105 aa overlap (66-170:1-105) 40 50 60 70 80 90 pF1KE3 RNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECG :::::::::::::::::::::::::::::: NP_001 MTLTRWTGMIIGPPRTIYENRIYSLKIECG 10 20 30 100 110 120 130 140 150 pF1KE3 PKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 PKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKE 40 50 60 70 80 90 160 170 pF1KE3 NMKLPQPPEGQCYSN ::::::::::::::: NP_001 NMKLPQPPEGQCYSN 100 170 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 05:11:13 2016 done: Sun Nov 6 05:11:14 2016 Total Scan time: 4.930 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]