Result of FASTA (ccds) for pFN21AB8522
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB8522, 879 aa
  1>>>pF1KB8522 879 - 879 aa - 879 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.3609+/-0.00132; mu= 20.6849+/- 0.079
 mean_var=73.7383+/-14.498, 0's: 0 Z-trim(100.8): 50  B-trim: 43 in 1/48
 Lambda= 0.149358
 statistics sampled from 6217 (6260) to 6217 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.532), E-opt: 0.2 (0.192), width:  16
 Scan time:  3.920

The best scores are:                                      opt bits E(32554)
CCDS5600.1 GRM3 gene_id:2913|Hs108|chr7            ( 879) 5921 1286.3       0
CCDS2834.1 GRM2 gene_id:2912|Hs108|chr3            ( 872) 4116 897.4       0
CCDS5794.1 GRM8 gene_id:2918|Hs108|chr7            ( 908) 2550 560.0 7.1e-159
CCDS47696.1 GRM8 gene_id:2918|Hs108|chr7           ( 908) 2550 560.0 7.1e-159
CCDS4787.1 GRM4 gene_id:2914|Hs108|chr6            ( 912) 2499 549.0 1.4e-155
CCDS43042.1 GRM7 gene_id:2917|Hs108|chr3           ( 915) 2494 547.9 3.1e-155
CCDS8283.1 GRM5 gene_id:2915|Hs108|chr11           (1180) 2352 517.4 6.1e-146
CCDS44694.1 GRM5 gene_id:2915|Hs108|chr11          (1212) 2352 517.4 6.2e-146
CCDS47497.1 GRM1 gene_id:2911|Hs108|chr6           ( 906) 2277 501.1 3.6e-141
CCDS64548.1 GRM1 gene_id:2911|Hs108|chr6           ( 908) 2277 501.1 3.6e-141
CCDS5209.1 GRM1 gene_id:2911|Hs108|chr6            (1194) 2277 501.2 4.5e-141
CCDS4442.1 GRM6 gene_id:2916|Hs108|chr5            ( 877) 2174 478.9 1.7e-134
CCDS59011.1 GRM4 gene_id:2914|Hs108|chr6           ( 743) 2031 448.1 2.8e-125
CCDS59010.1 GRM4 gene_id:2914|Hs108|chr6           ( 779) 2031 448.1 2.9e-125
CCDS59012.1 GRM4 gene_id:2914|Hs108|chr6           ( 796) 1371 305.9 1.9e-82
CCDS75432.1 GRM4 gene_id:2914|Hs108|chr6           ( 865) 1371 305.9   2e-82
CCDS30556.1 TAS1R3 gene_id:83756|Hs108|chr1        ( 852)  839 191.3 6.5e-48
CCDS187.1 TAS1R2 gene_id:80834|Hs108|chr1          ( 839)  801 183.1 1.9e-45
CCDS3010.1 CASR gene_id:846|Hs108|chr3             (1078)  724 166.5 2.3e-40
CCDS54632.1 CASR gene_id:846|Hs108|chr3            (1088)  695 160.3 1.7e-38
CCDS81.1 TAS1R1 gene_id:80835|Hs108|chr1           ( 841)  606 141.0 8.3e-33
CCDS5112.1 GPRC6A gene_id:222545|Hs108|chr6        ( 926)  558 130.7 1.2e-29
CCDS69184.1 GPRC6A gene_id:222545|Hs108|chr6       ( 855)  540 126.8 1.6e-28
CCDS69185.1 GPRC6A gene_id:222545|Hs108|chr6       ( 751)  453 108.0 6.4e-23


>>CCDS5600.1 GRM3 gene_id:2913|Hs108|chr7                 (879 aa)
 initn: 5921 init1: 5921 opt: 5921  Z-score: 6891.7  bits: 1286.3 E(32554):    0
Smith-Waterman score: 5921; 100.0% identity (100.0% similar) in 879 aa overlap (1-879:1-879)

               10        20        30        40        50        60
pF1KB8 MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
               10        20        30        40        50        60

               70        80        90       100       110       120
pF1KB8 NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
               70        80        90       100       110       120

              130       140       150       160       170       180
pF1KB8 DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
              130       140       150       160       170       180

              190       200       210       220       230       240
pF1KB8 KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
              190       200       210       220       230       240

              250       260       270       280       290       300
pF1KB8 IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
              250       260       270       280       290       300

              310       320       330       340       350       360
pF1KB8 DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
              310       320       330       340       350       360

              370       380       390       400       410       420
pF1KB8 CSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 CSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
              370       380       390       400       410       420

              430       440       450       460       470       480
pF1KB8 AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSY
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSY
              430       440       450       460       470       480

              490       500       510       520       530       540
pF1KB8 LKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 LKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
              490       500       510       520       530       540

              550       560       570       580       590       600
pF1KB8 ADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIK
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 ADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIK
              550       560       570       580       590       600

              610       620       630       640       650       660
pF1KB8 HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALL
              610       620       630       640       650       660

              670       680       690       700       710       720
pF1KB8 TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLA
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLA
              670       680       690       700       710       720

              730       740       750       760       770       780
pF1KB8 EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
              730       740       750       760       770       780

              790       800       810       820       830       840
pF1KB8 IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS56 IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
              790       800       810       820       830       840

              850       860       870         
pF1KB8 LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
       :::::::::::::::::::::::::::::::::::::::
CCDS56 LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
              850       860       870         

>>CCDS2834.1 GRM2 gene_id:2912|Hs108|chr3                 (872 aa)
 initn: 3844 init1: 1795 opt: 4116  Z-score: 4789.7  bits: 897.4 E(32554):    0
Smith-Waterman score: 4116; 68.7% identity (87.9% similar) in 857 aa overlap (30-879:23-872)

               10        20        30        40        50        60
pF1KB8 MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
                                    .. . .:::::::::::...::  .:.:: .
CCDS28        MGSLLALLALLLLWGAVAEGPAKKVLTLEGDLVLGGLFPVHQKGGPAEDCGPV
                      10        20        30        40        50   

               70        80        90       100       110          
pF1KB8 NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTK-
       :: ::::::::::::.:.::.: .:::::.::.::::.::.::.::::.:.::::::.. 
CCDS28 NEHRGIQRLEAMLFALDRINRDPHLLPGVRLGAHILDSCSKDTHALEQALDFVRASLSRG
            60        70        80        90       100       110   

     120       130       140       150       160       170         
pF1KB8 VDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLS
       .: ....::::::: . . :  :.::::::::.:::::::::::::::::::::::::::
CCDS28 ADGSRHICPDGSYATHGDAPTAITGVIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLS
           120       130       140       150       160       170   

     180       190       200       210       220       230         
pF1KB8 DKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNI
       ::::::::::::::::.::::::::::::::::::::::::::::::::::: ::: :::
CCDS28 DKSRYDYFARTVPPDFFQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFELEARARNI
           180       190       200       210       220       230   

     240       250       260       270       280       290         
pF1KB8 CIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVA
       :.::.:::::.  : ....:.: :::::.:::.::: ::.:.:::.::..: ::::::::
CCDS28 CVATSEKVGRAMSRAAFEGVVRALLQKPSARVAVLFTRSEDARELLAASQRLNASFTWVA
           240       250       260       270       280       290   

     300       310       320       330       340       350         
pF1KB8 SDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKF
       :::::: ::.. ::: .: ::::.:::: :. .:  :::::.:.:: ::::::.::::.:
CCDS28 SDGWGALESVVAGSEGAAEGAITIELASYPISDFASYFQSLDPWNNSRNPWFREFWEQRF
           300       310       320       330       340       350   

     360       370       380       390       400       410         
pF1KB8 QCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLC
       .::..     .: :  : .. .  .:::::::::::::::::::::.:.:.::::::.::
CCDS28 RCSFR-----QRDCAAH-SLRAVPFEQESKIMFVVNAVYAMAHALHNMHRALCPNTTRLC
                360        370       380       390       400       

     420       430       440       450       460       470         
pF1KB8 DAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVG-GKY
       :::. ..:..::::..:...: ::: :  :. . :.:: ::::.::::.:..  .: :.:
CCDS28 DAMRPVNGRRLYKDFVLNVKFDAPFRPA-DTHNEVRFDRFGDGIGRYNIFTYLRAGSGRY
       410       420       430        440       450       460      

      480       490       500          510       520       530     
pF1KB8 SYLKVGHWAETLSLDVNSIHWSRNS---VPTSQCSDPCAPNEMKNMQPGDVCCWICIPCE
        : :::.::: :.::.. : :.  :   .:.:.::.::  ::.:..:::.::::.::::.
CCDS28 RYQKVGYWAEGLTLDTSLIPWASPSAGPLPASRCSEPCLQNEVKSVQPGEVCCWLCIPCQ
        470       480       490       500       510       520      

         540       550       560       570       580       590     
pF1KB8 PYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVV
       ::::  ::::: ::: : ::.:.::::..::..:::: ::::.::::::::: . : .:.
CCDS28 PYEYRLDEFTCADCGLGYWPNASLTGCFELPQEYIRWGDAWAVGPVTIACLGALATLFVL
        530       540       550       560       570       580      

         600       610       620       630       640       650     
pF1KB8 TVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAIC
        ::..:: ::.::::::::::::: :: : :::::.:::::: ..:.:::::::..:..:
CCDS28 GVFVRHNATPVVKASGRELCYILLGGVFLCYCMTFIFIAKPSTAVCTLRRLGLGTAFSVC
        590       600       610       620       630       640      

         660       670       680       690       700       710     
pF1KB8 YSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTR
       ::::::::: ::::: :...:::::.::::.::: :::.::  :...: .::..::::: 
CCDS28 YSALLTKTNRIARIFGGAREGAQRPRFISPASQVAICLALISGQLLIVVAWLVVEAPGTG
        650       660       670       680       690       700      

         720       730       740       750       760       770     
pF1KB8 RYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTM
       . :  :.::.: :.:: .:.::: ::.:.:.:. :::.::::::::::::::::::::::
CCDS28 KETAPERREVVTLRCNHRDASMLGSLAYNVLLIALCTLYAFKTRKCPENFNEAKFIGFTM
        710       720       730       740       750       760      

         780       790       800       810       820       830     
pF1KB8 YTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVV
       :::::::::::::::::::::::::::::.:::::: ::::::::::.::::::::::::
CCDS28 YTTCIIWLAFLPIFYVTSSDYRVQTTTMCVSVSLSGSVVLGCLFAPKLHIILFQPQKNVV
        770       780       790       800       810       820      

         840         850       860       870         
pF1KB8 THRLHLNRFSVSGT--GTTYSQSSASTYVPTVCNGREVLDSTTSSL
       .::   .::. ...  ... .:.:.: .::::::::::.:::::::
CCDS28 SHRAPTSRFGSAAARASSSLGQGSGSQFVPTVCNGREVVDSTTSSL
        830       840       850       860       870  

>>CCDS5794.1 GRM8 gene_id:2918|Hs108|chr7                 (908 aa)
 initn: 1535 init1: 681 opt: 2550  Z-score: 2965.8  bits: 560.0 E(32554): 7.1e-159
Smith-Waterman score: 2550; 47.6% identity (75.0% similar) in 821 aa overlap (33-834:40-849)

             10        20        30        40        50        60  
pF1KB8 MLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRINE
                                     :...::..::::::.. ::     ::....
CCDS57 SCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGERGVPCGELKK
      10        20        30        40        50        60         

             70        80        90       100       110       120  
pF1KB8 DRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKVDE
       ..::.::::::.:::.::::  :: .. :::.:::::::::::::::: ::.: . : : 
CCDS57 EKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEK-DA
      70        80        90       100       110       120         

            130       140       150       160       170       180  
pF1KB8 AEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKS
       ..  : .:.  :  . :  :.::::.. :::::.:::.::::.:::::::::. .:::..
CCDS57 SDVKCANGDPPIFTK-PDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNT
      130       140        150       160       170       180       

            190       200       210       220       230        240 
pF1KB8 RYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEAR-LRNICI
       :::.:.:.:::: :::.::..:.  ..:.::::.::::.:::.:.::: : .: . ..::
CCDS57 RYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCI
       190       200       210       220       230       240       

             250       260       270       280       290           
pF1KB8 ATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANAS--FTWVA
       : ..:. :      ....:..::. ::::.:..:   :: :... ::.. : :  : :..
CCDS57 AQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIG
       250       260       270       280       290       300       

     300       310       320       330       340       350         
pF1KB8 SDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKF
       ::.::.. . .  .:..: ::.:.      .  :::::.: .  ::.:: :: .:::..:
CCDS57 SDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENF
       310       320       330       340       350       360       

     360          370         380       390       400       410    
pF1KB8 QCSL--QNKRN-HRRVCD--KHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPN
        :.:  ..::: : . :   ...: ::: ::::.:..::..:::.::.:::.:.. :::.
CCDS57 GCKLGSHGKRNSHIKKCTGLERIARDSS-YEQEGKVQFVIDAVYSMAYALHNMHKDLCPG
       370       380       390        400       410       420      

          420       430       440       450       460       470    
pF1KB8 TTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNV
          ::  :. .:::.:   :.  .::      : .: . : :.  ::. :::..:..: .
CCDS57 YIGLCPRMSTIDGKELL-GYIRAVNF------NGSAGTPVTFNENGDAPGRYDIFQYQIT
        430       440        450             460       470         

          480       490       500         510       520       530  
pF1KB8 GGKYSYLKVGHWAETLSLDVNSIHWSR--NSVPTSQCSDPCAPNEMKNMQPGDVCCWICI
       . .  :  .:::.. : : :....:..  .. :.: :: :: :.: :.   :  ::: : 
CCDS57 NKSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCE
     480       490       500       510       520       530         

            540       550       560       570       580       590  
pF1KB8 PCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTC
        :: :.: .::..:  :   : :. . :::  .:   ..:.. ::. :: .: ::.. : 
CCDS57 RCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATT
     540       550       560       570       580       590         

            600       610       620       630       640       650  
pF1KB8 MVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSF
       .:...:...:.::.:.:::::: :.:: :. : : .::..:: :. .::..::. :: ..
CCDS57 FVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGM
     600       610       620       630       640       650         

            660       670       680       690       700       710  
pF1KB8 AICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAP
        . :.::::::: : :::.  :...  ::::::.::. : ..:: ::.. : ::.... :
CCDS57 CFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPP
     660       670       680       690       700       710         

                  720       730       740       750       760      
pF1KB8 ------GTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFN
             : .: ::  ..   .:::...: :.. :: :...:.. :::::.:::  ::.::
CCDS57 HIIIDYGEQR-TLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFN
     720        730       740       750       760       770        

        770       780       790          800       810       820   
pF1KB8 EAKFIGFTMYTTCIIWLAFLPIFYVTSSD---YRVQTTTMCISVSLSGFVVLGCLFAPKV
       ::: :::::::::::::::.:::. :...   . .::::. .:.:::. : :: :. :::
CCDS57 EAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKV
      780       790       800       810       820       830        

           830       840       850       860       870             
pF1KB8 HIILFQPQKNVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL    
       .::.:.:..::                                                 
CCDS57 YIIIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKT
      840       850       860       870       880       890        

>>CCDS47696.1 GRM8 gene_id:2918|Hs108|chr7                (908 aa)
 initn: 1535 init1: 681 opt: 2550  Z-score: 2965.8  bits: 560.0 E(32554): 7.1e-159
Smith-Waterman score: 2550; 47.6% identity (75.0% similar) in 821 aa overlap (33-834:40-849)

             10        20        30        40        50        60  
pF1KB8 MLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRINE
                                     :...::..::::::.. ::     ::....
CCDS47 SCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGERGVPCGELKK
      10        20        30        40        50        60         

             70        80        90       100       110       120  
pF1KB8 DRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKVDE
       ..::.::::::.:::.::::  :: .. :::.:::::::::::::::: ::.: . : : 
CCDS47 EKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEK-DA
      70        80        90       100       110       120         

            130       140       150       160       170       180  
pF1KB8 AEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKS
       ..  : .:.  :  . :  :.::::.. :::::.:::.::::.:::::::::. .:::..
CCDS47 SDVKCANGDPPIFTK-PDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNT
      130       140        150       160       170       180       

            190       200       210       220       230        240 
pF1KB8 RYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEAR-LRNICI
       :::.:.:.:::: :::.::..:.  ..:.::::.::::.:::.:.::: : .: . ..::
CCDS47 RYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCI
       190       200       210       220       230       240       

             250       260       270       280       290           
pF1KB8 ATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANAS--FTWVA
       : ..:. :      ....:..::. ::::.:..:   :: :... ::.. : :  : :..
CCDS47 AQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIG
       250       260       270       280       290       300       

     300       310       320       330       340       350         
pF1KB8 SDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKF
       ::.::.. . .  .:..: ::.:.      .  :::::.: .  ::.:: :: .:::..:
CCDS47 SDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENF
       310       320       330       340       350       360       

     360          370         380       390       400       410    
pF1KB8 QCSL--QNKRN-HRRVCD--KHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPN
        :.:  ..::: : . :   ...: ::: ::::.:..::..:::.::.:::.:.. :::.
CCDS47 GCKLGSHGKRNSHIKKCTGLERIARDSS-YEQEGKVQFVIDAVYSMAYALHNMHKDLCPG
       370       380       390        400       410       420      

          420       430       440       450       460       470    
pF1KB8 TTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNV
          ::  :. .:::.:   :.  .::      : .: . : :.  ::. :::..:..: .
CCDS47 YIGLCPRMSTIDGKELL-GYIRAVNF------NGSAGTPVTFNENGDAPGRYDIFQYQIT
        430       440        450             460       470         

          480       490       500         510       520       530  
pF1KB8 GGKYSYLKVGHWAETLSLDVNSIHWSR--NSVPTSQCSDPCAPNEMKNMQPGDVCCWICI
       . .  :  .:::.. : : :....:..  .. :.: :: :: :.: :.   :  ::: : 
CCDS47 NKSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCE
     480       490       500       510       520       530         

            540       550       560       570       580       590  
pF1KB8 PCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTC
        :: :.: .::..:  :   : :. . :::  .:   ..:.. ::. :: .: ::.. : 
CCDS47 RCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATT
     540       550       560       570       580       590         

            600       610       620       630       640       650  
pF1KB8 MVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSF
       .:...:...:.::.:.:::::: :.:: :. : : .::..:: :. .::..::. :: ..
CCDS47 FVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGM
     600       610       620       630       640       650         

            660       670       680       690       700       710  
pF1KB8 AICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAP
        . :.::::::: : :::.  :...  ::::::.::. : ..:: ::.. : ::.... :
CCDS47 CFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPP
     660       670       680       690       700       710         

                  720       730       740       750       760      
pF1KB8 ------GTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFN
             : .: ::  ..   .:::...: :.. :: :...:.. :::::.:::  ::.::
CCDS47 HIIIDYGEQR-TLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFN
     720        730       740       750       760       770        

        770       780       790          800       810       820   
pF1KB8 EAKFIGFTMYTTCIIWLAFLPIFYVTSSD---YRVQTTTMCISVSLSGFVVLGCLFAPKV
       ::: :::::::::::::::.:::. :...   . .::::. .:.:::. : :: :. :::
CCDS47 EAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKV
      780       790       800       810       820       830        

           830       840       850       860       870             
pF1KB8 HIILFQPQKNVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL    
       .::.:.:..::                                                 
CCDS47 YIIIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNSKSSVE
      840       850       860       870       880       890        

>>CCDS4787.1 GRM4 gene_id:2914|Hs108|chr6                 (912 aa)
 initn: 2046 init1: 729 opt: 2499  Z-score: 2906.4  bits: 549.0 E(32554): 1.4e-155
Smith-Waterman score: 2499; 46.2% identity (72.4% similar) in 861 aa overlap (10-849:18-868)

                       10        20           30        40         
pF1KB8         MKMLTRLQVLTLALFSKGFLLSLGD---HNFLRREIKIEGDLVLGGLFPINE
                        : :.:..  .  :::    :  .   :.:.::..::::::.. 
CCDS47 MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNS-IRIDGDITLGGLFPVHG
               10        20        30        40         50         

      50        60        70        80        90       100         
pF1KB8 KGTGTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQS
       .:.  . ::......::.::::::::.:.::.:  :::.. ::..:::::::::.:::::
CCDS47 RGSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQS
      60        70        80        90       100       110         

     110       120       130       140       150       160         
pF1KB8 LEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQI
       : ::.: . : : .:  : .:.  :  . :  ..::::.: :::::.:::.::::.::::
CCDS47 LTFVQALIEK-DGTEVRCGSGGPPIITK-PERVVGVIGASGSSVSIMVANILRLFKIPQI
     120        130       140        150       160       170       

     170       180       190       200       210       220         
pF1KB8 SYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEA
       :::::.  :::.::::.:.:.:: : :::.::..:.: ..:.:::::::::.:::.:.::
CCDS47 SYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEA
       180       190       200       210       220       230       

     230        240       250       260       270       280        
pF1KB8 FEQEARLRN-ICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAA
       : :..:  . .::: . :. :      .:..::.::.  :::.:..:   :: :... ::
CCDS47 FIQKSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAA
       240       250       260       270       280       290       

      290         300       310       320       330       340      
pF1KB8 SRANAS--FTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNH
        ::: .  : :..::.::.. . .   :.:: ::.:.    . :: :::::.: .  ::.
CCDS47 RRANQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNR
       300       310       320       330       340       350       

        350       360           370        380       390       400 
pF1KB8 RNPWFRDFWEQKFQCSLQ----NKRNHRRVCDKHLAI-DSSNYEQESKIMFVVNAVYAMA
       :: :: .:::..:.:.:.    .: .: . : ..  : ..: ::::.:..::..:::::.
CCDS47 RNIWFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMG
       360       370       380       390       400       410       

             410       420       430       440       450       460 
pF1KB8 HALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGD
       :::: :.: :::. . ::  :  .:: .: : :. ..::..       : . : :.  ::
CCDS47 HALHAMHRDLCPGRVGLCPRMDPVDGTQLLK-YIRNVNFSGI------AGNPVTFNENGD
       420       430       440        450             460       470

             470       480       490         500       510         
pF1KB8 GMGRYNVFNFQNVGGKYSYLKVGHWAETLSLDVNSIHW--SRNSVPTSQCSDPCAPNEMK
       . :::.....:  . .  :  .: :.. : : .. .::  : ...: : :: :: :.: :
CCDS47 APGRYDIYQYQLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERK
              480       490       500       510       520       530

     520       530       540       550       560       570         
pF1KB8 NMQPGDVCCWICIPCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIG
       .   :  ::: : ::  :.: .:..::  :   . :: . :::  .:   ..: . ::. 
CCDS47 KTVKGMPCCWHCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVL
              540       550       560       570       580       590

     580       590       600       610       620       630         
pF1KB8 PVTIACLGFMCTCMVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPV
       :. .: .:.  : .:: .:...:.::.:::::::: :.:: :. : :  ::..::.:.  
CCDS47 PLFLAVVGIAATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLG
              600       610       620       630       640       650

     640       650       660       670       680       690         
pF1KB8 ICALRRLGLGSSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQ
        :.:::. :: ...: :.::::::: : :::.  : ... :.::::.::. : ..:: .:
CCDS47 TCSLRRIFLGLGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQ
              660       670       680       690       700       710

     700       710            720       730       740       750    
pF1KB8 IVMVSVWLILEAPGT-----RRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVY
       .. . ::....   .      . ::  .    .:::...: :..  : :...:.. ::::
CCDS47 LLGICVWFVVDPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVY
              720       730       740       750       760       770

          760       770       780       790          800       810 
pF1KB8 AFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSD---YRVQTTTMCISVSLSG
       :.:::  ::.::::: ::::::::::.::::.:::. ::..     .::::. .:::::.
CCDS47 AIKTRGVPETFNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSA
              780       790       800       810       820       830

             820       830       840       850       860       870 
pF1KB8 FVVLGCLFAPKVHIILFQPQKNVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTVCNGREV
        : :: :. :::.::::.:..::  ..  :.   ...:                      
CCDS47 SVSLGMLYMPKVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELC
              840       850       860       870       880       890

                             
pF1KB8 LDSTTSSL              
                             
CCDS47 ENLEAPALATKQTYVTYTNHAI
              900       910  

>>CCDS43042.1 GRM7 gene_id:2917|Hs108|chr3                (915 aa)
 initn: 2342 init1: 663 opt: 2494  Z-score: 2900.6  bits: 547.9 E(32554): 3.1e-155
Smith-Waterman score: 2494; 45.7% identity (74.3% similar) in 849 aa overlap (7-834:21-856)

                             10        20        30        40      
pF1KB8               MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFP
                           :.::  :: .     . :.. .  . :.::::..::::::
CCDS43 MVQLRKLLRVLTLMKFPCCVLEVLLCALAAA----ARGQEMYAPHSIRIEGDVTLGGLFP
               10        20        30            40        50      

         50        60        70        80        90       100      
pF1KB8 INEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYAL
       .. :: .   :: :... ::.::::::.:.:.::.:  :::.: ::..::::::::::::
CCDS43 VHAKGPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYAL
         60        70        80        90       100       110      

        110       120       130       140       150       160      
pF1KB8 EQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQI
       :::: ::.: . : : ..  : .:   .  . :  ..::::.: :::::.:::.::::::
CCDS43 EQSLTFVQALIQK-DTSDVRCTNGEPPVFVK-PEKVVGVIGASGSSVSIMVANILRLFQI
        120        130       140        150       160       170    

        170       180       190       200       210       220      
pF1KB8 PQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETG
       ::::::::. .:::  :::.:.:.:::: .::.::..:.. ..:.::::.::::.::: :
CCDS43 PQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKG
          180       190       200       210       220       230    

        230        240         250       260       270       280   
pF1KB8 IEAFEQEARLRN-ICIATAEKVG--RSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRE
       .:.: : ..  . .::: . ..   :..   ..: .:..::. ::.:.::.:  ..: ..
CCDS43 VESFTQISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQ
          240       250       260       270       280       290    

           290         300       310       320       330       340 
pF1KB8 LIAAASRAN--ASFTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLN
       ..:::.::.  . : ::.::.::.. . ..  : .: ::::..     :. :: :: : .
CCDS43 ILAAAKRADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRT
          300       310       320       330       340       350    

             350       360           370       380        390      
pF1KB8 PYNNHRNPWFRDFWEQKFQCSL----QNKRNHRRVCDKHLAIDS-SNYEQESKIMFVVNA
         ::.:: :: ..::..:.:.:    ..:..  : :  .  : . ::::::.:..::..:
CCDS43 LENNRRNVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDA
          360       370       380       390       400       410    

        400       410       420       430       440       450      
pF1KB8 VYAMAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKF
       :::::::::.:.. :: .   .:  :.   :::: : :. ..::      : .: . : :
CCDS43 VYAMAHALHHMNKDLCADYRGVCPEMEQAGGKKLLK-YIRNVNF------NGSAGTPVMF
          420       430       440       450              460       

        460       470        480       490       500         510   
pF1KB8 DTFGDGMGRYNVFNFQNVG-GKYSYLKVGHWAETLSLDVNSIHWSRN--SVPTSQCSDPC
       .  ::. :::..:..:... .. .:  .:.:.. :.:......:...   .:.: :. ::
CCDS43 NKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPC
       470       480       490       500       510       520       

           520       530       540       550       560       570   
pF1KB8 APNEMKNMQPGDVCCWICIPCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWE
        :.. :. : :  ::: : ::. :.:  ::.::. :   : :. . ::: :.:   ..:.
CCDS43 KPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWH
       530       540       550       560       570       580       

           580       590       600       610       620       630   
pF1KB8 DAWAIGPVTIACLGFMCTCMVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFI
       . ::. :: .: ::.. : .:...::..:.::.:.:::::: :.:: :. : : .::..:
CCDS43 SPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMI
       590       600       610       620       630       640       

           640       650       660       670       680       690   
pF1KB8 AKPSPVICALRRLGLGSSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICL
       :::. ..:..::. :: .. : :.::::::: : :::.  :...  :..:::.::. :  
CCDS43 AKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITS
       650       660       670       680       690       700       

           700       710            720       730       740        
pF1KB8 GLILVQIVMVSVWLILEAPGT-----RRYTLAEKRETVILKCNVKDSSMLISLTYDVILV
       .:: ::.. : .:. .. :.      .. :.  ..   .:::.. : ... :: :...:.
CCDS43 SLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLM
       710       720       730       740       750       760       

      750       760       770       780       790          800     
pF1KB8 ILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYR---VQTTTMCI
       . :::::.:::  :::::::: ::::::::::.::::.:::. :... .   .::::. :
CCDS43 VTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTI
       770       780       790       800       810       820       

         810       820       830       840       850       860     
pF1KB8 SVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTV
       :..::. :.:: :. :::.::.:.:. ::                               
CCDS43 SMNLSASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGE
       830       840       850       860       870       880       

>>CCDS8283.1 GRM5 gene_id:2915|Hs108|chr11                (1180 aa)
 initn: 1838 init1: 809 opt: 2352  Z-score: 2733.6  bits: 517.4 E(32554): 6.1e-146
Smith-Waterman score: 2352; 44.1% identity (73.1% similar) in 854 aa overlap (30-860:25-860)

               10        20        30         40        50         
pF1KB8 MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREI-KIEGDLVLGGLFPINEKGT----GTE
                                    :: . .. ::...:.:: .... :      .
CCDS82      MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHER
                    10        20        30        40        50     

          60        70        80        90       100       110     
pF1KB8 ECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRA
       .:: . :. ::::.:::: ....::.:  :::.. :: .: :.: ... :::::.::.: 
CCDS82 KCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRD
          60        70        80        90       100       110     

         120         130        140       150       160       170  
pF1KB8 SLTKVDEAEYM--CPDGSYA-IQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYA
       :: . .: : .  : ::: . .. . :  :.:::: . :::.::: :::.::.::::.:.
CCDS82 SLISSEEEEGLVRCVDGSSSSFRSKKP--IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYS
         120       130       140         150       160       170   

            180       190       200       210       220       230  
pF1KB8 STSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQ
       .::  ::::. . :: :.:: :  ::.::..:.. .::::::.: .::.:::.:.:::..
CCDS82 ATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD
           180       190       200       210       220       230   

            240       250       260        270       280       290 
pF1KB8 EARLRNICIATAEKVGRSNIRKSYDSVIRELLQK-PNARVVVLFMRSDDSRELIAAASRA
        .  ..:::: . :.  .  ..:.:.....: .. :.::::. : ..   : :. :  : 
CCDS82 MSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRL
           240       250       260       270       280       290   

               300       310       320       330       340         
pF1KB8 NAS--FTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNP
       . .  :  ..::::. . ..  : .. : :.::..: :  :. :: :. .: : .:::::
CCDS82 GLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNP
           300       310       320       330       340       350   

     350       360           370       380       390       400     
pF1KB8 WFRDFWEQKFQCSL----QNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALH
       ::..::...::: :    :.. .. ..:.. :.. .... :.::. ::.::.:.::..::
CCDS82 WFQEFWQHRFQCRLEGFPQENSKYNKTCNSSLTL-KTHHVQDSKMGFVINAIYSMAYGLH
           360       370       380        390       400       410  

         410       420       430       440       450       460     
pF1KB8 KMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGR
       .:: .:::. . :::::: .::.:: .. :.: :::.      ..:.:. ::  ::. ::
CCDS82 NMQMSLCPGYAGLCDAMKPIDGRKLLES-LMKTNFTGV-----SGDTIL-FDENGDSPGR
            420       430       440             450        460     

         470        480        490       500        510       520  
pF1KB8 YNVFNFQNVGGKY-SYLKVGHWAE-TLSLDVNSIHWSRNS-VPTSQCSDPCAPNEMKNMQ
       :...::...:  : .:..:: : .  :..: . . ::..: .  : ::.::  ...: ..
CCDS82 YEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEV-WSKKSNIIRSVCSEPCEKGQIKVIR
         470       480       490        500       510       520    

             530       540       550       560       570       580 
pF1KB8 PGDV-CCWICIPCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPV
        :.: ::: : ::.  ::. ::.::  :  :.::: :::::  .: .:.:: :   :. :
CCDS82 KGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAV
          530       540       550       560       570       580    

             590       600       610       620       630       640 
pF1KB8 TIACLGFMCTCMVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVIC
       ..::::.. : .:..::: . .::.::.:.::::::.: :. :.:  :: .::::. . :
CCDS82 VFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYC
          590       600       610       620       630       640    

             650       660       670         680       690         
pF1KB8 ALRRLGLGSSFAICYSALLTKTNCIARIFDGVKNG--AQRPKFISPSSQVFICLGLILVQ
        :.:.:.: : :. ::::.:::: ::::. : :.   ...:.:.:  .:. : . :: .:
CCDS82 YLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQ
          650       660       670       680       690       700    

     700       710       720       730       740       750         
pF1KB8 IVMVSVWLILEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTR
       . .. . .:.: :    .     :: : : ::. . ...  : :. .:.. :: ::::::
CCDS82 LGIIVALFIMEPPDIM-HDYPSIRE-VYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTR
          710       720         730       740       750       760  

     760       770       780       790       800       810         
pF1KB8 KCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLF
       . : ::::::.:.:::::::::::::.::..  .:.:..   :::.:::::. :.:::.:
CCDS82 NVPANFNEAKYIAFTMYTTCIIWLAFVPIYF--GSNYKI--ITMCFSVSLSATVALGCMF
            770       780       790           800       810        

     820       830       840         850       860       870       
pF1KB8 APKVHIILFQPQKNVVTHRLH--LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTS
       .:::.::: .:..:: .      . :. : : : . : .: :.                 
CCDS82 VPKVYIILAKPERNVRSAFTTSTVVRMHV-GDGKSSSAASRSSSLVNLWKRRGSSGETLS
      820       830       840        850       860       870       

                                                                   
pF1KB8 SL                                                          
                                                                   
CCDS82 SNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRGLGAGAGAGG
       880       890       900       910       920       930       

>>CCDS44694.1 GRM5 gene_id:2915|Hs108|chr11               (1212 aa)
 initn: 1838 init1: 809 opt: 2352  Z-score: 2733.4  bits: 517.4 E(32554): 6.2e-146
Smith-Waterman score: 2352; 44.1% identity (73.1% similar) in 854 aa overlap (30-860:25-860)

               10        20        30         40        50         
pF1KB8 MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREI-KIEGDLVLGGLFPINEKGT----GTE
                                    :: . .. ::...:.:: .... :      .
CCDS44      MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHER
                    10        20        30        40        50     

          60        70        80        90       100       110     
pF1KB8 ECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRA
       .:: . :. ::::.:::: ....::.:  :::.. :: .: :.: ... :::::.::.: 
CCDS44 KCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRD
          60        70        80        90       100       110     

         120         130        140       150       160       170  
pF1KB8 SLTKVDEAEYM--CPDGSYA-IQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYA
       :: . .: : .  : ::: . .. . :  :.:::: . :::.::: :::.::.::::.:.
CCDS44 SLISSEEEEGLVRCVDGSSSSFRSKKP--IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYS
         120       130       140         150       160       170   

            180       190       200       210       220       230  
pF1KB8 STSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQ
       .::  ::::. . :: :.:: :  ::.::..:.. .::::::.: .::.:::.:.:::..
CCDS44 ATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD
           180       190       200       210       220       230   

            240       250       260        270       280       290 
pF1KB8 EARLRNICIATAEKVGRSNIRKSYDSVIRELLQK-PNARVVVLFMRSDDSRELIAAASRA
        .  ..:::: . :.  .  ..:.:.....: .. :.::::. : ..   : :. :  : 
CCDS44 MSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRL
           240       250       260       270       280       290   

               300       310       320       330       340         
pF1KB8 NAS--FTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNP
       . .  :  ..::::. . ..  : .. : :.::..: :  :. :: :. .: : .:::::
CCDS44 GLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNP
           300       310       320       330       340       350   

     350       360           370       380       390       400     
pF1KB8 WFRDFWEQKFQCSL----QNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALH
       ::..::...::: :    :.. .. ..:.. :.. .... :.::. ::.::.:.::..::
CCDS44 WFQEFWQHRFQCRLEGFPQENSKYNKTCNSSLTL-KTHHVQDSKMGFVINAIYSMAYGLH
           360       370       380        390       400       410  

         410       420       430       440       450       460     
pF1KB8 KMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGR
       .:: .:::. . :::::: .::.:: .. :.: :::.      ..:.:. ::  ::. ::
CCDS44 NMQMSLCPGYAGLCDAMKPIDGRKLLES-LMKTNFTGV-----SGDTIL-FDENGDSPGR
            420       430       440             450        460     

         470        480        490       500        510       520  
pF1KB8 YNVFNFQNVGGKY-SYLKVGHWAE-TLSLDVNSIHWSRNS-VPTSQCSDPCAPNEMKNMQ
       :...::...:  : .:..:: : .  :..: . . ::..: .  : ::.::  ...: ..
CCDS44 YEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEV-WSKKSNIIRSVCSEPCEKGQIKVIR
         470       480       490        500       510       520    

             530       540       550       560       570       580 
pF1KB8 PGDV-CCWICIPCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPV
        :.: ::: : ::.  ::. ::.::  :  :.::: :::::  .: .:.:: :   :. :
CCDS44 KGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAV
          530       540       550       560       570       580    

             590       600       610       620       630       640 
pF1KB8 TIACLGFMCTCMVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVIC
       ..::::.. : .:..::: . .::.::.:.::::::.: :. :.:  :: .::::. . :
CCDS44 VFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYC
          590       600       610       620       630       640    

             650       660       670         680       690         
pF1KB8 ALRRLGLGSSFAICYSALLTKTNCIARIFDGVKNG--AQRPKFISPSSQVFICLGLILVQ
        :.:.:.: : :. ::::.:::: ::::. : :.   ...:.:.:  .:. : . :: .:
CCDS44 YLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQ
          650       660       670       680       690       700    

     700       710       720       730       740       750         
pF1KB8 IVMVSVWLILEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTR
       . .. . .:.: :    .     :: : : ::. . ...  : :. .:.. :: ::::::
CCDS44 LGIIVALFIMEPPDIM-HDYPSIRE-VYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTR
          710       720         730       740       750       760  

     760       770       780       790       800       810         
pF1KB8 KCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLF
       . : ::::::.:.:::::::::::::.::..  .:.:..   :::.:::::. :.:::.:
CCDS44 NVPANFNEAKYIAFTMYTTCIIWLAFVPIYF--GSNYKI--ITMCFSVSLSATVALGCMF
            770       780       790           800       810        

     820       830       840         850       860       870       
pF1KB8 APKVHIILFQPQKNVVTHRLH--LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTS
       .:::.::: .:..:: .      . :. : : : . : .: :.                 
CCDS44 VPKVYIILAKPERNVRSAFTTSTVVRMHV-GDGKSSSAASRSSSLVNLWKRRGSSGETLR
      820       830       840        850       860       870       

                                                                   
pF1KB8 SL                                                          
                                                                   
CCDS44 YKDRRLAQHKSEIECFTPKGSMGNGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHI
       880       890       900       910       920       930       

>>CCDS47497.1 GRM1 gene_id:2911|Hs108|chr6                (906 aa)
 initn: 2027 init1: 796 opt: 2277  Z-score: 2647.9  bits: 501.1 E(32554): 3.6e-141
Smith-Waterman score: 2314; 44.1% identity (72.2% similar) in 839 aa overlap (16-834:22-846)

                     10        20        30        40        50    
pF1KB8       MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGT
                            : :  . :.  .  :   ...::...:.:: ....  . 
CCDS47 MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
               10        20        30        40        50        60

               60        70        80        90       100       110
pF1KB8 E----ECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSL
       .    .::.: :. ::::.:::. ..:.:: :  :::.. :: .: :.: ... :::::.
CCDS47 KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
               70        80        90       100       110       120

              120           130       140       150       160      
pF1KB8 EFVRASLTKV-DEAEYM--C-PDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQI
       ::.: :: .. :: . .  : :::.          :::::: . :::.::: :::.::.:
CCDS47 EFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
              130       140       150       160       170       180

        170       180       190       200       210       220      
pF1KB8 PQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETG
       :::.:..::  ::::. : :: :.:: :  ::.:: .:.. .::::::.: .::.:::.:
CCDS47 PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
              190       200       210       220       230       240

        230       240       250       260        270       280     
pF1KB8 IEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQK-PNARVVVLFMRSDDSRELI
       ..::.. :  ...::: ..:.  .  .::.: ..:.: .. :.::::: : ..   : :.
CCDS47 MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
              250       260       270       280       290       300

         290         300       310       320       330       340   
pF1KB8 AAASRANA--SFTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPY
       .:  : ..   :. ..::::. .. .:.: :  : :.::..: :  ::.:: :: .:   
CCDS47 SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
              310       320       330       340       350       360

           350       360           370       380       390         
pF1KB8 NNHRNPWFRDFWEQKFQCSLQNKR----NHRRVCDKHLAIDSSNYEQESKIMFVVNAVYA
       .: ::::: .::...::: : ..     : .:.:  . ...  :: :.::. ::.::.::
CCDS47 TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEE-NYVQDSKMGFVINAIYA
              370       380       390       400        410         

     400       410       420       430       440       450         
pF1KB8 MAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTF
       :::.:..:...:::. . :::::: .::.::  :.:.: .: .  . .      : ::  
CCDS47 MAHGLQNMHHALCPGHVGLCDAMKPIDGSKLL-DFLIKSSFIGVSGEE------VWFDEK
     420       430       440       450        460             470  

     460       470        480        490       500       510       
pF1KB8 GDGMGRYNVFNFQNV-GGKYSYLKVGHWAE-TLSLDVNSIHWSRNSVPTSQCSDPCAPNE
       ::. :::...:.: . ...:.:..:: : : .:..:  .:. ....:  : ::.::  ..
CCDS47 GDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQ
            480       490       500       510       520       530  

       520        530       540       550       560       570      
pF1KB8 MKNMQPGDV-CCWICIPCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAW
       .: .. :.: :::::  :.  ::. :::::  :  : ::.::::::  .:  :..: .  
CCDS47 IKVIRKGEVSCCWICTACKENEYVQDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIE
            540       550       560       570       580       590  

        580       590       600       610       620       630      
pF1KB8 AIGPVTIACLGFMCTCMVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKP
       .:  ....:::.. : .:. .:. . .::.::.:.::::::.: :. :.:   : .::::
CCDS47 SIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKP
            600       610       620       630       640       650  

        640       650       660       670         680       690    
pF1KB8 SPVICALRRLGLGSSFAICYSALLTKTNCIARIFDGVKNG--AQRPKFISPSSQVFICLG
       . . : :.:: .: : :.:::::.:::: ::::. : :.   ...:.:.:  .::.:   
CCDS47 TTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASI
            660       670       680       690       700       710  

          700       710       720       730       740       750    
pF1KB8 LILVQIVMVSVWLILEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVY
       :: ::...: . .:.: :     .    .: : : ::... ...  : :. .:.. :: :
CCDS47 LISVQLTLVVTLIIMEPPMPI-LSYPSIKE-VYLICNTSNLGVVAPLGYNGLLIMSCTYY
            720       730        740        750       760       770

          760       770       780       790       800       810    
pF1KB8 AFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVV
       :::::. : ::::::.:.:::::::::::::.::..  .:.:.. ::  :..::::  :.
CCDS47 AFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYF--GSNYKIITT--CFAVSLSVTVA
              780       790       800         810         820      

          820       830       840       850       860       870    
pF1KB8 LGCLFAPKVHIILFQPQKNVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDS
       :::.:.::..::. .:..::                                        
CCDS47 LGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNA
        830       840       850       860       870       880      

>>CCDS64548.1 GRM1 gene_id:2911|Hs108|chr6                (908 aa)
 initn: 2089 init1: 796 opt: 2277  Z-score: 2647.9  bits: 501.1 E(32554): 3.6e-141
Smith-Waterman score: 2314; 44.1% identity (72.2% similar) in 839 aa overlap (16-834:22-846)

                     10        20        30        40        50    
pF1KB8       MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGT
                            : :  . :.  .  :   ...::...:.:: ....  . 
CCDS64 MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
               10        20        30        40        50        60

               60        70        80        90       100       110
pF1KB8 E----ECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSL
       .    .::.: :. ::::.:::. ..:.:: :  :::.. :: .: :.: ... :::::.
CCDS64 KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
               70        80        90       100       110       120

              120           130       140       150       160      
pF1KB8 EFVRASLTKV-DEAEYM--C-PDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQI
       ::.: :: .. :: . .  : :::.          :::::: . :::.::: :::.::.:
CCDS64 EFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
              130       140       150       160       170       180

        170       180       190       200       210       220      
pF1KB8 PQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETG
       :::.:..::  ::::. : :: :.:: :  ::.:: .:.. .::::::.: .::.:::.:
CCDS64 PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
              190       200       210       220       230       240

        230       240       250       260        270       280     
pF1KB8 IEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQK-PNARVVVLFMRSDDSRELI
       ..::.. :  ...::: ..:.  .  .::.: ..:.: .. :.::::: : ..   : :.
CCDS64 MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
              250       260       270       280       290       300

         290         300       310       320       330       340   
pF1KB8 AAASRANA--SFTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPY
       .:  : ..   :. ..::::. .. .:.: :  : :.::..: :  ::.:: :: .:   
CCDS64 SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
              310       320       330       340       350       360

           350       360           370       380       390         
pF1KB8 NNHRNPWFRDFWEQKFQCSLQNKR----NHRRVCDKHLAIDSSNYEQESKIMFVVNAVYA
       .: ::::: .::...::: : ..     : .:.:  . ...  :: :.::. ::.::.::
CCDS64 TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEE-NYVQDSKMGFVINAIYA
              370       380       390       400        410         

     400       410       420       430       440       450         
pF1KB8 MAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTF
       :::.:..:...:::. . :::::: .::.::  :.:.: .: .  . .      : ::  
CCDS64 MAHGLQNMHHALCPGHVGLCDAMKPIDGSKLL-DFLIKSSFIGVSGEE------VWFDEK
     420       430       440       450        460             470  

     460       470        480        490       500       510       
pF1KB8 GDGMGRYNVFNFQNV-GGKYSYLKVGHWAE-TLSLDVNSIHWSRNSVPTSQCSDPCAPNE
       ::. :::...:.: . ...:.:..:: : : .:..:  .:. ....:  : ::.::  ..
CCDS64 GDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQ
            480       490       500       510       520       530  

       520        530       540       550       560       570      
pF1KB8 MKNMQPGDV-CCWICIPCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAW
       .: .. :.: :::::  :.  ::. :::::  :  : ::.::::::  .:  :..: .  
CCDS64 IKVIRKGEVSCCWICTACKENEYVQDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIE
            540       550       560       570       580       590  

        580       590       600       610       620       630      
pF1KB8 AIGPVTIACLGFMCTCMVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKP
       .:  ....:::.. : .:. .:. . .::.::.:.::::::.: :. :.:   : .::::
CCDS64 SIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKP
            600       610       620       630       640       650  

        640       650       660       670         680       690    
pF1KB8 SPVICALRRLGLGSSFAICYSALLTKTNCIARIFDGVKNG--AQRPKFISPSSQVFICLG
       . . : :.:: .: : :.:::::.:::: ::::. : :.   ...:.:.:  .::.:   
CCDS64 TTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASI
            660       670       680       690       700       710  

          700       710       720       730       740       750    
pF1KB8 LILVQIVMVSVWLILEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVY
       :: ::...: . .:.: :     .    .: : : ::... ...  : :. .:.. :: :
CCDS64 LISVQLTLVVTLIIMEPPMPI-LSYPSIKE-VYLICNTSNLGVVAPLGYNGLLIMSCTYY
            720       730        740        750       760       770

          760       770       780       790       800       810    
pF1KB8 AFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVV
       :::::. : ::::::.:.:::::::::::::.::..  .:.:.. ::  :..::::  :.
CCDS64 AFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYF--GSNYKIITT--CFAVSLSVTVA
              780       790       800         810         820      

          820       830       840       850       860       870    
pF1KB8 LGCLFAPKVHIILFQPQKNVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDS
       :::.:.::..::. .:..::                                        
CCDS64 LGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNA
        830       840       850       860       870       880      




879 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 20:58:55 2016 done: Sun Nov  6 20:58:56 2016
 Total Scan time:  3.920 Total Display time:  0.350

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com