Result of FASTA (ccds) for pFN21AE0260
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0260, 98 aa
  1>>>pF1KE0260 98 - 98 aa - 98 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.1292+/-0.000589; mu= 9.6314+/- 0.035
 mean_var=55.5021+/-10.901, 0's: 0 Z-trim(111.3): 7  B-trim: 0 in 0/50
 Lambda= 0.172155
 statistics sampled from 12262 (12265) to 12262 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.763), E-opt: 0.2 (0.377), width:  16
 Scan time:  1.440

The best scores are:                                      opt bits E(32554)
CCDS3818.1 SCRG1 gene_id:11341|Hs108|chr4          (  98)  707 182.8 2.9e-47


>>CCDS3818.1 SCRG1 gene_id:11341|Hs108|chr4               (98 aa)
 initn: 707 init1: 707 opt: 707  Z-score: 962.1  bits: 182.8 E(32554): 2.9e-47
Smith-Waterman score: 707; 100.0% identity (100.0% similar) in 98 aa overlap (1-98:1-98)

               10        20        30        40        50        60
pF1KE0 MKLMVLVFTIGLTLLLGVQAMPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFW
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS38 MKLMVLVFTIGLTLLLGVQAMPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFW
               10        20        30        40        50        60

               70        80        90        
pF1KE0 DGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
       ::::::::::::::::::::::::::::::::::::::
CCDS38 DGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
               70        80        90        




98 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Thu Nov  3 18:39:29 2016 done: Thu Nov  3 18:39:29 2016
 Total Scan time:  1.440 Total Display time: -0.050

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com