FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1101, 71 aa 1>>>pF1KE1101 71 - 71 aa - 71 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0844+/-0.000506; mu= 8.4840+/- 0.031 mean_var=56.6506+/-11.003, 0's: 0 Z-trim(113.8): 1 B-trim: 0 in 0/52 Lambda= 0.170401 statistics sampled from 14426 (14427) to 14426 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.826), E-opt: 0.2 (0.443), width: 16 Scan time: 1.320 The best scores are: opt bits E(32554) CCDS10016.1 SNURF gene_id:8926|Hs108|chr15 ( 71) 470 122.4 2.3e-29 >>CCDS10016.1 SNURF gene_id:8926|Hs108|chr15 (71 aa) initn: 470 init1: 470 opt: 470 Z-score: 640.7 bits: 122.4 E(32554): 2.3e-29 Smith-Waterman score: 470; 100.0% identity (100.0% similar) in 71 aa overlap (1-71:1-71) 10 20 30 40 50 60 pF1KE1 MERARDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRSQQQQVPVVDFQAELR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 MERARDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRSQQQQVPVVDFQAELR 10 20 30 40 50 60 70 pF1KE1 QAFLAETPRGG ::::::::::: CCDS10 QAFLAETPRGG 70 71 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 21:28:56 2016 done: Sun Nov 6 21:28:56 2016 Total Scan time: 1.320 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]