Result of FASTA (ccds) for pFN21AE0128
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0128, 101 aa
  1>>>pF1KE0128 101 - 101 aa - 101 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.4929+/-0.000673; mu= 12.7189+/- 0.040
 mean_var=46.1432+/- 9.456, 0's: 0 Z-trim(107.2): 8  B-trim: 0 in 0/48
 Lambda= 0.188808
 statistics sampled from 9443 (9446) to 9443 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.695), E-opt: 0.2 (0.29), width:  16
 Scan time:  1.400

The best scores are:                                      opt bits E(32554)
CCDS35430.1 VMA21 gene_id:203547|Hs108|chrX        ( 101)  650 183.9 1.5e-47


>>CCDS35430.1 VMA21 gene_id:203547|Hs108|chrX             (101 aa)
 initn: 650 init1: 650 opt: 650  Z-score: 967.3  bits: 183.9 E(32554): 1.5e-47
Smith-Waterman score: 650; 100.0% identity (100.0% similar) in 101 aa overlap (1-101:1-101)

               10        20        30        40        50        60
pF1KE0 MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMS
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS35 MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMS
               10        20        30        40        50        60

               70        80        90       100 
pF1KE0 NRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD
       :::::::::::::::::::::::::::::::::::::::::
CCDS35 NRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD
               70        80        90       100 




101 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 01:50:20 2016 done: Fri Nov  4 01:50:20 2016
 Total Scan time:  1.400 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com