FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5107, 103 aa
  1>>>pF1KE5107 103 - 103 aa - 103 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0455+/-0.000579; mu= 10.1638+/- 0.035
 mean_var=50.3261+/- 9.835, 0's: 0 Z-trim(111.1): 18  B-trim: 0 in 0/50
 Lambda= 0.180791
 statistics sampled from 12067 (12085) to 12067 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.776), E-opt: 0.2 (0.371), width:  16
 Scan time:  1.480

The best scores are:                                      opt bits E(32554)
CCDS45907.1 LSM7 gene_id:51690|Hs108|chr19         ( 103)  681 184.5 9.9e-48


>>CCDS45907.1 LSM7 gene_id:51690|Hs108|chr19              (103 aa)
 initn: 681 init1: 681 opt: 681  Z-score: 970.4  bits: 184.5 E(32554): 9.9e-48
Smith-Waterman score: 681; 100.0% identity (100.0% similar) in 103 aa overlap (1-103:1-103)

               10        20        30        40        50        60
pF1KE5 MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS45 MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDD
               10        20        30        40        50        60

               70        80        90       100   
pF1KE5 QYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA
       :::::::::::::::::::::::::::::::::::::::::::
CCDS45 QYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA
               70        80        90       100   




103 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 21:23:21 2016 done: Mon Nov  7 21:23:22 2016
 Total Scan time:  1.480 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]