Result of FASTA (ccds) for pFN21AB0901
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB0901, 80 aa
  1>>>pF1KB0901 80 - 80 aa - 80 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.3539+/-0.000433; mu= 14.1980+/- 0.026
 mean_var=55.7314+/-10.876, 0's: 0 Z-trim(116.7): 15  B-trim: 0 in 0/52
 Lambda= 0.171800
 statistics sampled from 17356 (17372) to 17356 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.872), E-opt: 0.2 (0.534), width:  16
 Scan time:  1.520

The best scores are:                                      opt bits E(32554)
CCDS12446.1 FXYD7 gene_id:53822|Hs108|chr19        (  80)  531 137.7 7.1e-34


>>CCDS12446.1 FXYD7 gene_id:53822|Hs108|chr19             (80 aa)
 initn: 531 init1: 531 opt: 531  Z-score: 721.6  bits: 137.7 E(32554): 7.1e-34
Smith-Waterman score: 531; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:1-80)

               10        20        30        40        50        60
pF1KB0 MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSES
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSES
               10        20        30        40        50        60

               70        80
pF1KB0 PTCKSCKSELPSSAPGGGGV
       ::::::::::::::::::::
CCDS12 PTCKSCKSELPSSAPGGGGV
               70        80




80 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sat Nov  5 17:54:26 2016 done: Sat Nov  5 17:54:26 2016
 Total Scan time:  1.520 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com