FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6149, 145 aa 1>>>pF1KE6149 145 - 145 aa - 145 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.7771+/-0.000648; mu= 7.0986+/- 0.039 mean_var=124.9872+/-25.177, 0's: 0 Z-trim(115.7): 4 B-trim: 0 in 0/52 Lambda= 0.114721 statistics sampled from 16284 (16286) to 16284 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.828), E-opt: 0.2 (0.5), width: 16 Scan time: 1.480 The best scores are: opt bits E(32554) CCDS6297.1 BAALC gene_id:79870|Hs108|chr8 ( 145) 997 174.4 2.1e-44 CCDS47906.1 BAALC gene_id:79870|Hs108|chr8 ( 54) 383 72.5 3.8e-14 >>CCDS6297.1 BAALC gene_id:79870|Hs108|chr8 (145 aa) initn: 997 init1: 997 opt: 997 Z-score: 910.7 bits: 174.4 E(32554): 2.1e-44 Smith-Waterman score: 997; 100.0% identity (100.0% similar) in 145 aa overlap (1-145:1-145) 10 20 30 40 50 60 pF1KE6 MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSGMLEDGL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS62 MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSGMLEDGL 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE6 PSNGVPRSTAPGGIPNPEKKTNCETQCPNPQSLSSGPLTQKQNGLQTTEAKRDAKRMPAK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS62 PSNGVPRSTAPGGIPNPEKKTNCETQCPNPQSLSSGPLTQKQNGLQTTEAKRDAKRMPAK 70 80 90 100 110 120 130 140 pF1KE6 EVTINVTDSIQQMDRSRRITKNCVN ::::::::::::::::::::::::: CCDS62 EVTINVTDSIQQMDRSRRITKNCVN 130 140 >>CCDS47906.1 BAALC gene_id:79870|Hs108|chr8 (54 aa) initn: 383 init1: 383 opt: 383 Z-score: 367.5 bits: 72.5 E(32554): 3.8e-14 Smith-Waterman score: 383; 100.0% identity (100.0% similar) in 54 aa overlap (1-54:1-54) 10 20 30 40 50 60 pF1KE6 MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSGMLEDGL :::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS47 MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSG 10 20 30 40 50 70 80 90 100 110 120 pF1KE6 PSNGVPRSTAPGGIPNPEKKTNCETQCPNPQSLSSGPLTQKQNGLQTTEAKRDAKRMPAK 145 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:52:52 2016 done: Tue Nov 8 09:52:53 2016 Total Scan time: 1.480 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]