FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6122, 86 aa
  1>>>pF1KE6122 86 - 86 aa - 86 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6500+/-0.000271; mu= 11.4182+/- 0.017
 mean_var=53.1922+/-10.709, 0's: 0 Z-trim(118.8): 11  B-trim: 0 in 0/49
 Lambda= 0.175853
 statistics sampled from 32112 (32123) to 32112 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.78), E-opt: 0.2 (0.377), width:  16
 Scan time:  2.590

The best scores are:                                      opt bits E(85289)
NP_001854 (OMIM: 124089,220110) cytochrome c oxida (  86)  632 167.3 2.8e-42


>>NP_001854 (OMIM: 124089,220110) cytochrome c oxidase s  (86 aa)
 initn: 632 init1: 632 opt: 632  Z-score: 880.1  bits: 167.3 E(85289): 2.8e-42
Smith-Waterman score: 632; 100.0% identity (100.0% similar) in 86 aa overlap (1-86:1-86)

               10        20        30        40        50        60
pF1KE6 MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRV
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_001 MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRV
               10        20        30        40        50        60

               70        80      
pF1KE6 YQSLCPTSWVTDWDEQRAEGTFPGKI
       ::::::::::::::::::::::::::
NP_001 YQSLCPTSWVTDWDEQRAEGTFPGKI
               70        80      




86 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:38:33 2016 done: Tue Nov  8 09:38:34 2016
 Total Scan time:  2.590 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]