FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3645, 74 aa 1>>>pF1KE3645 74 - 74 aa - 74 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8089+/-0.000244; mu= 10.6680+/- 0.015 mean_var=62.5783+/-12.330, 0's: 0 Z-trim(122.0): 42 B-trim: 62 in 1/52 Lambda= 0.162130 statistics sampled from 39340 (39382) to 39340 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.837), E-opt: 0.2 (0.462), width: 16 Scan time: 4.090 The best scores are: opt bits E(85289) NP_001316355 (OMIM: 189970) guanine nucleotide-bin ( 74) 490 121.6 1.1e-28 NP_068774 (OMIM: 189970) guanine nucleotide-bindin ( 74) 490 121.6 1.1e-28 NP_004117 (OMIM: 604390) guanine nucleotide-bindin ( 73) 380 95.9 6.2e-21 NP_001185685 (OMIM: 139391) guanine nucleotide-bin ( 69) 294 75.8 6.7e-15 NP_113686 (OMIM: 139391) guanine nucleotide-bindin ( 69) 294 75.8 6.7e-15 NP_001185683 (OMIM: 139391) guanine nucleotide-bin ( 69) 294 75.8 6.7e-15 NP_001185684 (OMIM: 139391) guanine nucleotide-bin ( 69) 294 75.8 6.7e-15 NP_061329 (OMIM: 615405) guanine nucleotide-bindin ( 72) 158 44.0 2.6e-05 XP_016857298 (OMIM: 615405) PREDICTED: guanine nuc ( 72) 158 44.0 2.6e-05 XP_016857299 (OMIM: 615405) PREDICTED: guanine nuc ( 72) 158 44.0 2.6e-05 XP_016857300 (OMIM: 615405) PREDICTED: guanine nuc ( 72) 158 44.0 2.6e-05 XP_016882095 (OMIM: 604430) PREDICTED: guanine nuc ( 68) 152 42.6 6.6e-05 NP_443079 (OMIM: 604430) guanine nucleotide-bindin ( 68) 152 42.6 6.6e-05 XP_006720236 (OMIM: 606981) PREDICTED: guanine nuc ( 71) 152 42.6 6.9e-05 XP_016876866 (OMIM: 606981) PREDICTED: guanine nuc ( 71) 152 42.6 6.9e-05 NP_001230702 (OMIM: 606981) guanine nucleotide-bin ( 71) 152 42.6 6.9e-05 NP_444292 (OMIM: 606981) guanine nucleotide-bindin ( 71) 152 42.6 6.9e-05 XP_016876865 (OMIM: 606981) PREDICTED: guanine nuc ( 71) 152 42.6 6.9e-05 XP_011535148 (OMIM: 606981) PREDICTED: guanine nuc ( 71) 152 42.6 6.9e-05 NP_001230703 (OMIM: 606981) guanine nucleotide-bin ( 71) 152 42.6 6.9e-05 NP_036334 (OMIM: 608941) guanine nucleotide-bindin ( 75) 147 41.4 0.00016 XP_006718563 (OMIM: 608941) PREDICTED: guanine nuc ( 75) 147 41.4 0.00016 NP_001092191 (OMIM: 604388) guanine nucleotide-bin ( 75) 142 40.2 0.00036 XP_006711824 (OMIM: 604388) PREDICTED: guanine nuc ( 75) 142 40.2 0.00036 NP_004476 (OMIM: 604388) guanine nucleotide-bindin ( 75) 142 40.2 0.00036 XP_011542469 (OMIM: 604388) PREDICTED: guanine nuc ( 75) 142 40.2 0.00036 NP_001092192 (OMIM: 604388) guanine nucleotide-bin ( 75) 142 40.2 0.00036 NP_001017998 (OMIM: 604389) guanine nucleotide-bin ( 68) 129 37.2 0.0028 NP_001185593 (OMIM: 604389) guanine nucleotide-bin ( 68) 129 37.2 0.0028 >>NP_001316355 (OMIM: 189970) guanine nucleotide-binding (74 aa) initn: 490 init1: 490 opt: 490 Z-score: 635.8 bits: 121.6 E(85289): 1.1e-28 Smith-Waterman score: 490; 100.0% identity (100.0% similar) in 74 aa overlap (1-74:1-74) 10 20 30 40 50 60 pF1KE3 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED 10 20 30 40 50 60 70 pF1KE3 KNPFKELKGGCVIS :::::::::::::: NP_001 KNPFKELKGGCVIS 70 >>NP_068774 (OMIM: 189970) guanine nucleotide-binding pr (74 aa) initn: 490 init1: 490 opt: 490 Z-score: 635.8 bits: 121.6 E(85289): 1.1e-28 Smith-Waterman score: 490; 100.0% identity (100.0% similar) in 74 aa overlap (1-74:1-74) 10 20 30 40 50 60 pF1KE3 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_068 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED 10 20 30 40 50 60 70 pF1KE3 KNPFKELKGGCVIS :::::::::::::: NP_068 KNPFKELKGGCVIS 70 >>NP_004117 (OMIM: 604390) guanine nucleotide-binding pr (73 aa) initn: 378 init1: 350 opt: 380 Z-score: 496.8 bits: 95.9 E(85289): 6.2e-21 Smith-Waterman score: 380; 75.7% identity (93.2% similar) in 74 aa overlap (1-74:1-73) 10 20 30 40 50 60 pF1KE3 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED ::...:::: ::.::::::.::.::: :.:. :::: ::...:.:::::::::::::::: NP_004 MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED 10 20 30 40 50 60 70 pF1KE3 KNPFKELKGGCVIS :::::: ::.:::: NP_004 KNPFKE-KGSCVIS 70 >>NP_001185685 (OMIM: 139391) guanine nucleotide-binding (69 aa) initn: 292 init1: 260 opt: 294 Z-score: 388.5 bits: 75.8 E(85289): 6.7e-15 Smith-Waterman score: 294; 64.7% identity (86.8% similar) in 68 aa overlap (7-74:3-69) 10 20 30 40 50 60 pF1KE3 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED .::.::: :::::.:::::: :. .:: .:...::: ..:.::..:::::: NP_001 MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPED 10 20 30 40 50 70 pF1KE3 KNPFKELKGGCVIS :::::: ::::.:: NP_001 KNPFKE-KGGCLIS 60 >>NP_113686 (OMIM: 139391) guanine nucleotide-binding pr (69 aa) initn: 292 init1: 260 opt: 294 Z-score: 388.5 bits: 75.8 E(85289): 6.7e-15 Smith-Waterman score: 294; 64.7% identity (86.8% similar) in 68 aa overlap (7-74:3-69) 10 20 30 40 50 60 pF1KE3 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED .::.::: :::::.:::::: :. .:: .:...::: ..:.::..:::::: NP_113 MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPED 10 20 30 40 50 70 pF1KE3 KNPFKELKGGCVIS :::::: ::::.:: NP_113 KNPFKE-KGGCLIS 60 >>NP_001185683 (OMIM: 139391) guanine nucleotide-binding (69 aa) initn: 292 init1: 260 opt: 294 Z-score: 388.5 bits: 75.8 E(85289): 6.7e-15 Smith-Waterman score: 294; 64.7% identity (86.8% similar) in 68 aa overlap (7-74:3-69) 10 20 30 40 50 60 pF1KE3 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED .::.::: :::::.:::::: :. .:: .:...::: ..:.::..:::::: NP_001 MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPED 10 20 30 40 50 70 pF1KE3 KNPFKELKGGCVIS :::::: ::::.:: NP_001 KNPFKE-KGGCLIS 60 >>NP_001185684 (OMIM: 139391) guanine nucleotide-binding (69 aa) initn: 292 init1: 260 opt: 294 Z-score: 388.5 bits: 75.8 E(85289): 6.7e-15 Smith-Waterman score: 294; 64.7% identity (86.8% similar) in 68 aa overlap (7-74:3-69) 10 20 30 40 50 60 pF1KE3 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED .::.::: :::::.:::::: :. .:: .:...::: ..:.::..:::::: NP_001 MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPED 10 20 30 40 50 70 pF1KE3 KNPFKELKGGCVIS :::::: ::::.:: NP_001 KNPFKE-KGGCLIS 60 >>NP_061329 (OMIM: 615405) guanine nucleotide-binding pr (72 aa) initn: 155 init1: 144 opt: 158 Z-score: 216.3 bits: 44.0 E(85289): 2.6e-05 Smith-Waterman score: 158; 45.5% identity (74.5% similar) in 55 aa overlap (19-73:18-71) 10 20 30 40 50 60 pF1KE3 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED :.::. :...::. ::: .. .: ::.. :::. ::: . NP_061 MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTS 10 20 30 40 50 70 pF1KE3 KNPFKELKGGCVIS .::::. : :.: NP_061 ENPFKD-KKTCIIL 60 70 >>XP_016857298 (OMIM: 615405) PREDICTED: guanine nucleot (72 aa) initn: 155 init1: 144 opt: 158 Z-score: 216.3 bits: 44.0 E(85289): 2.6e-05 Smith-Waterman score: 158; 45.5% identity (74.5% similar) in 55 aa overlap (19-73:18-71) 10 20 30 40 50 60 pF1KE3 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED :.::. :...::. ::: .. .: ::.. :::. ::: . XP_016 MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTS 10 20 30 40 50 70 pF1KE3 KNPFKELKGGCVIS .::::. : :.: XP_016 ENPFKD-KKTCIIL 60 70 >>XP_016857299 (OMIM: 615405) PREDICTED: guanine nucleot (72 aa) initn: 155 init1: 144 opt: 158 Z-score: 216.3 bits: 44.0 E(85289): 2.6e-05 Smith-Waterman score: 158; 45.5% identity (74.5% similar) in 55 aa overlap (19-73:18-71) 10 20 30 40 50 60 pF1KE3 MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED :.::. :...::. ::: .. .: ::.. :::. ::: . XP_016 MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTS 10 20 30 40 50 70 pF1KE3 KNPFKELKGGCVIS .::::. : :.: XP_016 ENPFKD-KKTCIIL 60 70 74 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 00:18:17 2016 done: Mon Nov 7 00:18:18 2016 Total Scan time: 4.090 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]