FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6118, 80 aa 1>>>pF1KE6118 80 - 80 aa - 80 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.4820+/-0.000297; mu= 11.2316+/- 0.018 mean_var=40.5372+/- 8.062, 0's: 0 Z-trim(116.2): 22 B-trim: 234 in 1/54 Lambda= 0.201441 statistics sampled from 27150 (27172) to 27150 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.728), E-opt: 0.2 (0.319), width: 16 Scan time: 2.440 The best scores are: opt bits E(85289) NP_001857 (OMIM: 300885,300887) cytochrome c oxida ( 80) 545 164.5 1.6e-41 XP_011511935 (OMIM: 609811) PREDICTED: cytochrome ( 81) 428 130.5 2.8e-31 XP_011511933 (OMIM: 609811) PREDICTED: cytochrome ( 81) 428 130.5 2.8e-31 XP_011511939 (OMIM: 609811) PREDICTED: cytochrome ( 81) 428 130.5 2.8e-31 XP_011511932 (OMIM: 609811) PREDICTED: cytochrome ( 81) 428 130.5 2.8e-31 XP_011511937 (OMIM: 609811) PREDICTED: cytochrome ( 81) 428 130.5 2.8e-31 XP_011511934 (OMIM: 609811) PREDICTED: cytochrome ( 81) 428 130.5 2.8e-31 XP_005248113 (OMIM: 609811) PREDICTED: cytochrome ( 81) 428 130.5 2.8e-31 XP_011511936 (OMIM: 609811) PREDICTED: cytochrome ( 81) 428 130.5 2.8e-31 NP_570972 (OMIM: 609811) cytochrome c oxidase subu ( 81) 428 130.5 2.8e-31 XP_011511940 (OMIM: 609811) PREDICTED: cytochrome ( 81) 428 130.5 2.8e-31 XP_011511938 (OMIM: 609811) PREDICTED: cytochrome ( 81) 428 130.5 2.8e-31 >>NP_001857 (OMIM: 300885,300887) cytochrome c oxidase s (80 aa) initn: 545 init1: 545 opt: 545 Z-score: 866.4 bits: 164.5 E(85289): 1.6e-41 Smith-Waterman score: 545; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:1-80) 10 20 30 40 50 60 pF1KE6 MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQV 10 20 30 40 50 60 70 80 pF1KE6 GIEWNLSPVGRVTPKEWRNQ :::::::::::::::::::: NP_001 GIEWNLSPVGRVTPKEWRNQ 70 80 >>XP_011511935 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 435 init1: 428 opt: 428 Z-score: 682.6 bits: 130.5 E(85289): 2.8e-31 Smith-Waterman score: 428; 70.0% identity (96.2% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQ ::::...::. :...:: :.:::.:: :..:::::::::::::::..::..::...::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 VGIEWNLSPVGRVTPKEWRNQ .:::::::::::::::::..: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511933 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 435 init1: 428 opt: 428 Z-score: 682.6 bits: 130.5 E(85289): 2.8e-31 Smith-Waterman score: 428; 70.0% identity (96.2% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQ ::::...::. :...:: :.:::.:: :..:::::::::::::::..::..::...::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 VGIEWNLSPVGRVTPKEWRNQ .:::::::::::::::::..: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511939 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 435 init1: 428 opt: 428 Z-score: 682.6 bits: 130.5 E(85289): 2.8e-31 Smith-Waterman score: 428; 70.0% identity (96.2% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQ ::::...::. :...:: :.:::.:: :..:::::::::::::::..::..::...::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 VGIEWNLSPVGRVTPKEWRNQ .:::::::::::::::::..: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511932 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 435 init1: 428 opt: 428 Z-score: 682.6 bits: 130.5 E(85289): 2.8e-31 Smith-Waterman score: 428; 70.0% identity (96.2% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQ ::::...::. :...:: :.:::.:: :..:::::::::::::::..::..::...::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 VGIEWNLSPVGRVTPKEWRNQ .:::::::::::::::::..: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511937 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 435 init1: 428 opt: 428 Z-score: 682.6 bits: 130.5 E(85289): 2.8e-31 Smith-Waterman score: 428; 70.0% identity (96.2% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQ ::::...::. :...:: :.:::.:: :..:::::::::::::::..::..::...::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 VGIEWNLSPVGRVTPKEWRNQ .:::::::::::::::::..: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511934 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 435 init1: 428 opt: 428 Z-score: 682.6 bits: 130.5 E(85289): 2.8e-31 Smith-Waterman score: 428; 70.0% identity (96.2% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQ ::::...::. :...:: :.:::.:: :..:::::::::::::::..::..::...::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 VGIEWNLSPVGRVTPKEWRNQ .:::::::::::::::::..: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_005248113 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 435 init1: 428 opt: 428 Z-score: 682.6 bits: 130.5 E(85289): 2.8e-31 Smith-Waterman score: 428; 70.0% identity (96.2% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQ ::::...::. :...:: :.:::.:: :..:::::::::::::::..::..::...::: XP_005 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 VGIEWNLSPVGRVTPKEWRNQ .:::::::::::::::::..: XP_005 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>XP_011511936 (OMIM: 609811) PREDICTED: cytochrome c ox (81 aa) initn: 435 init1: 428 opt: 428 Z-score: 682.6 bits: 130.5 E(85289): 2.8e-31 Smith-Waterman score: 428; 70.0% identity (96.2% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQ ::::...::. :...:: :.:::.:: :..:::::::::::::::..::..::...::: XP_011 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 VGIEWNLSPVGRVTPKEWRNQ .:::::::::::::::::..: XP_011 IGIEWNLSPVGRVTPKEWKHQ 70 80 >>NP_570972 (OMIM: 609811) cytochrome c oxidase subunit (81 aa) initn: 435 init1: 428 opt: 428 Z-score: 682.6 bits: 130.5 E(85289): 2.8e-31 Smith-Waterman score: 428; 70.0% identity (96.2% similar) in 80 aa overlap (1-80:2-81) 10 20 30 40 50 pF1KE6 MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQ ::::...::. :...:: :.:::.:: :..:::::::::::::::..::..::...::: NP_570 MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ 10 20 30 40 50 60 60 70 80 pF1KE6 VGIEWNLSPVGRVTPKEWRNQ .:::::::::::::::::..: NP_570 IGIEWNLSPVGRVTPKEWKHQ 70 80 80 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:36:22 2016 done: Tue Nov 8 09:36:22 2016 Total Scan time: 2.440 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]