FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6146, 98 aa
  1>>>pF1KE6146 98 - 98 aa - 98 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8595+/-0.000592; mu= 11.3113+/- 0.036
 mean_var=52.4120+/-10.634, 0's: 0 Z-trim(110.5): 10  B-trim: 2 in 1/51
 Lambda= 0.177157
 statistics sampled from 11632 (11637) to 11632 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.76), E-opt: 0.2 (0.357), width:  16
 Scan time:  1.310

The best scores are:                                      opt bits E(32554)
CCDS2336.1 NDUFB3 gene_id:4709|Hs108|chr2          (  98)  701 186.1 2.9e-48


>>CCDS2336.1 NDUFB3 gene_id:4709|Hs108|chr2               (98 aa)
 initn: 701 init1: 701 opt: 701  Z-score: 979.9  bits: 186.1 E(32554): 2.9e-48
Smith-Waterman score: 701; 100.0% identity (100.0% similar) in 98 aa overlap (1-98:1-98)

               10        20        30        40        50        60
pF1KE6 MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKS
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS23 MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKS
               10        20        30        40        50        60

               70        80        90        
pF1KE6 VSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
       ::::::::::::::::::::::::::::::::::::::
CCDS23 VSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
               70        80        90        




98 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:51:25 2016 done: Tue Nov  8 09:51:26 2016
 Total Scan time:  1.310 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]