FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KB6711, 79 aa 1>>>pF1KB6711 79 - 79 aa - 79 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.4990+/-0.00047; mu= 11.7100+/- 0.028 mean_var=48.3211+/- 9.557, 0's: 0 Z-trim(113.5): 7 B-trim: 0 in 0/54 Lambda= 0.184504 statistics sampled from 14093 (14097) to 14093 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.819), E-opt: 0.2 (0.433), width: 16 Scan time: 1.310 The best scores are: opt bits E(32554) CCDS1077.1 CKS1B gene_id:1163|Hs108|chr1 ( 79) 561 155.6 2.9e-39 CCDS6682.1 CKS2 gene_id:1164|Hs108|chr9 ( 79) 466 130.3 1.2e-31 >>CCDS1077.1 CKS1B gene_id:1163|Hs108|chr1 (79 aa) initn: 561 init1: 561 opt: 561 Z-score: 818.4 bits: 155.6 E(32554): 2.9e-39 Smith-Waterman score: 561; 100.0% identity (100.0% similar) in 79 aa overlap (1-79:1-79) 10 20 30 40 50 60 pF1KB6 MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIH :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIH 10 20 30 40 50 60 70 pF1KB6 EPEPHILLFRRPLPKKPKK ::::::::::::::::::: CCDS10 EPEPHILLFRRPLPKKPKK 70 >>CCDS6682.1 CKS2 gene_id:1164|Hs108|chr9 (79 aa) initn: 469 init1: 458 opt: 466 Z-score: 681.8 bits: 130.3 E(32554): 1.2e-31 Smith-Waterman score: 466; 81.0% identity (91.1% similar) in 79 aa overlap (1-79:1-79) 10 20 30 40 50 60 pF1KB6 MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIH :.:::::::::: ::..::::::::....: ::::::::: ::: :::::: :::::::: CCDS66 MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH 10 20 30 40 50 60 70 pF1KB6 EPEPHILLFRRPLPKKPKK ::::::::::::::: .: CCDS66 EPEPHILLFRRPLPKDQQK 70 79 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 01:19:32 2016 done: Mon Nov 7 01:19:32 2016 Total Scan time: 1.310 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]