Result of FASTA (omim) for pFN21AE6105
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6105, 82 aa
  1>>>pF1KE6105 82 - 82 aa - 82 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.4171+/-0.000294; mu= 11.8480+/- 0.018
 mean_var=42.8559+/- 8.658, 0's: 0 Z-trim(115.8): 7  B-trim: 256 in 1/53
 Lambda= 0.195916
 statistics sampled from 26529 (26534) to 26529 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.716), E-opt: 0.2 (0.311), width:  16
 Scan time:  3.490

The best scores are:                                      opt bits E(85289)
NP_057181 (OMIM: 609382,614231) immediate early re (  82)  519 153.1 4.8e-38


>>NP_057181 (OMIM: 609382,614231) immediate early respon  (82 aa)
 initn: 519 init1: 519 opt: 519  Z-score: 804.1  bits: 153.1 E(85289): 4.8e-38
Smith-Waterman score: 519; 100.0% identity (100.0% similar) in 82 aa overlap (1-82:1-82)

               10        20        30        40        50        60
pF1KE6 MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVR
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_057 MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVR
               10        20        30        40        50        60

               70        80  
pF1KE6 TVMRVPLIIVNSIAIVLLLLFG
       ::::::::::::::::::::::
NP_057 TVMRVPLIIVNSIAIVLLLLFG
               70        80  




82 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:29:54 2016 done: Tue Nov  8 09:29:54 2016
 Total Scan time:  3.490 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com