FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0201, 83 aa
  1>>>pF1KE0201 83 - 83 aa - 83 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8782+/-0.000502; mu= 11.2984+/- 0.030
 mean_var=59.8578+/-11.839, 0's: 0 Z-trim(114.5): 1  B-trim: 97 in 1/53
 Lambda= 0.165773
 statistics sampled from 15022 (15023) to 15022 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.834), E-opt: 0.2 (0.461), width:  16
 Scan time:  1.530

The best scores are:                                      opt bits E(32554)
CCDS12648.1 APOC1 gene_id:341|Hs108|chr19          (  83)  515 130.0 1.6e-31


>>CCDS12648.1 APOC1 gene_id:341|Hs108|chr19               (83 aa)
 initn: 515 init1: 515 opt: 515  Z-score: 679.2  bits: 130.0 E(32554): 1.6e-31
Smith-Waterman score: 515; 100.0% identity (100.0% similar) in 83 aa overlap (1-83:1-83)

               10        20        30        40        50        60
pF1KE0 MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL
               10        20        30        40        50        60

               70        80   
pF1KE0 SAKMREWFSETFQKVKEKLKIDS
       :::::::::::::::::::::::
CCDS12 SAKMREWFSETFQKVKEKLKIDS
               70        80   




83 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Thu Nov  3 21:37:02 2016 done: Thu Nov  3 21:37:02 2016
 Total Scan time:  1.530 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]