Result of FASTA (ccds) for pFN21AE5122
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5122, 113 aa
  1>>>pF1KE5122 113 - 113 aa - 113 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.5437+/-0.000759; mu= 13.7811+/- 0.046
 mean_var=53.5438+/-11.498, 0's: 0 Z-trim(106.7): 12  B-trim: 528 in 1/49
 Lambda= 0.175275
 statistics sampled from 9112 (9115) to 9112 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.669), E-opt: 0.2 (0.28), width:  16
 Scan time:  1.300

The best scores are:                                      opt bits E(32554)
CCDS9571.1 DAD1 gene_id:1603|Hs108|chr14           ( 113)  727 191.2 1.1e-49


>>CCDS9571.1 DAD1 gene_id:1603|Hs108|chr14                (113 aa)
 initn: 727 init1: 727 opt: 727  Z-score: 1005.3  bits: 191.2 E(32554): 1.1e-49
Smith-Waterman score: 727; 100.0% identity (100.0% similar) in 113 aa overlap (1-113:1-113)

               10        20        30        40        50        60
pF1KE5 MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS95 MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
               10        20        30        40        50        60

               70        80        90       100       110   
pF1KE5 ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
       :::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS95 ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
               70        80        90       100       110   




113 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 07:18:20 2016 done: Tue Nov  8 07:18:20 2016
 Total Scan time:  1.300 Total Display time: -0.050

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com