FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6202, 189 aa 1>>>pF1KE6202 189 - 189 aa - 189 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.3597+/-0.000671; mu= 12.0931+/- 0.040 mean_var=55.9425+/-11.077, 0's: 0 Z-trim(108.7): 22 B-trim: 7 in 1/49 Lambda= 0.171476 statistics sampled from 10345 (10356) to 10345 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.708), E-opt: 0.2 (0.318), width: 16 Scan time: 1.470 The best scores are: opt bits E(32554) CCDS33925.1 APOD gene_id:347|Hs108|chr3 ( 189) 1276 323.3 5.4e-89 >>CCDS33925.1 APOD gene_id:347|Hs108|chr3 (189 aa) initn: 1276 init1: 1276 opt: 1276 Z-score: 1711.2 bits: 323.3 E(32554): 5.4e-89 Smith-Waterman score: 1276; 100.0% identity (100.0% similar) in 189 aa overlap (1-189:1-189) 10 20 30 40 50 60 pF1KE6 MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS33 MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGR 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE6 CIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS33 CIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWI 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE6 LATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS33 LATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVT 130 140 150 160 170 180 pF1KE6 DQVNCPKLS ::::::::: CCDS33 DQVNCPKLS 189 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 11:03:03 2016 done: Tue Nov 8 11:03:03 2016 Total Scan time: 1.470 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]