FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5125, 98 aa 1>>>pF1KE5125 98 - 98 aa - 98 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8013+/-0.000287; mu= 11.5333+/- 0.018 mean_var=51.4678+/-10.018, 0's: 0 Z-trim(117.4): 5 B-trim: 54 in 1/50 Lambda= 0.178775 statistics sampled from 29445 (29449) to 29445 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.745), E-opt: 0.2 (0.345), width: 16 Scan time: 4.050 The best scores are: opt bits E(85289) NP_000091 (OMIM: 254800,601145) cystatin-B [Homo s ( 98) 647 173.8 3.9e-44 NP_005204 (OMIM: 184600,607936) cystatin-A [Homo s ( 98) 345 95.9 1.1e-20 >>NP_000091 (OMIM: 254800,601145) cystatin-B [Homo sapie (98 aa) initn: 647 init1: 647 opt: 647 Z-score: 913.4 bits: 173.8 E(85289): 3.9e-44 Smith-Waterman score: 647; 100.0% identity (100.0% similar) in 98 aa overlap (1-98:1-98) 10 20 30 40 50 60 pF1KE5 MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_000 MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVG 10 20 30 40 50 60 70 80 90 pF1KE5 DEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF :::::::::::::::::::::::::::::::::::::: NP_000 DEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF 70 80 90 >>NP_005204 (OMIM: 184600,607936) cystatin-A [Homo sapie (98 aa) initn: 350 init1: 330 opt: 345 Z-score: 492.4 bits: 95.9 E(85289): 1.1e-20 Smith-Waterman score: 345; 53.1% identity (83.7% similar) in 98 aa overlap (1-98:1-98) 10 20 30 40 50 60 pF1KE5 MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVG :. :. : ..::: : :.:.:.:. ::::: :. . ..::..:.::::::::.:::..: NP_005 MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAG 10 20 30 40 50 60 70 80 90 pF1KE5 DEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF :. ..::.::.::: .:. :.:..::..: : :::: : NP_005 DNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF 70 80 90 98 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:38:24 2016 done: Mon Nov 7 21:38:24 2016 Total Scan time: 4.050 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]