FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5121, 123 aa 1>>>pF1KE5121 123 - 123 aa - 123 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.8374+/-0.000746; mu= 9.6772+/- 0.045 mean_var=90.7379+/-17.594, 0's: 0 Z-trim(110.9): 6 B-trim: 0 in 0/50 Lambda= 0.134642 statistics sampled from 11950 (11951) to 11950 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.724), E-opt: 0.2 (0.367), width: 16 Scan time: 1.400 The best scores are: opt bits E(32554) CCDS6858.1 RPL35 gene_id:11224|Hs108|chr9 ( 123) 761 156.6 3.4e-39 >>CCDS6858.1 RPL35 gene_id:11224|Hs108|chr9 (123 aa) initn: 761 init1: 761 opt: 761 Z-score: 817.1 bits: 156.6 E(32554): 3.4e-39 Smith-Waterman score: 761; 100.0% identity (100.0% similar) in 123 aa overlap (1-123:1-123) 10 20 30 40 50 60 pF1KE5 MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS68 MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTV 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 INQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS68 INQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYA 70 80 90 100 110 120 pF1KE5 VKA ::: CCDS68 VKA 123 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:36:53 2016 done: Mon Nov 7 21:36:54 2016 Total Scan time: 1.400 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]