FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6135, 105 aa
  1>>>pF1KE6135 105 - 105 aa - 105 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.1714+/-0.000681; mu= 10.5625+/- 0.041
 mean_var=58.3007+/-11.882, 0's: 0 Z-trim(109.2): 12  B-trim: 194 in 1/51
 Lambda= 0.167972
 statistics sampled from 10730 (10733) to 10730 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.718), E-opt: 0.2 (0.33), width:  16
 Scan time:  1.020

The best scores are:                                      opt bits E(32554)
CCDS12147.1 RPL36 gene_id:25873|Hs108|chr19        ( 105)  677 171.5 8.3e-44


>>CCDS12147.1 RPL36 gene_id:25873|Hs108|chr19             (105 aa)
 initn: 677 init1: 677 opt: 677  Z-score: 899.9  bits: 171.5 E(32554): 8.3e-44
Smith-Waterman score: 677; 100.0% identity (100.0% similar) in 105 aa overlap (1-105:1-105)

               10        20        30        40        50        60
pF1KE6 MALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMEL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 MALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMEL
               10        20        30        40        50        60

               70        80        90       100     
pF1KE6 LKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRKAAAKKD
       :::::::::::::::::::::::::::::::::::::::::::::
CCDS12 LKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRKAAAKKD
               70        80        90       100     




105 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:46:08 2016 done: Tue Nov  8 09:46:08 2016
 Total Scan time:  1.020 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]