FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1103, 137 aa 1>>>pF1KE1103 137 - 137 aa - 137 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 8.0196+/-0.000647; mu= 1.4734+/- 0.040 mean_var=157.1616+/-32.142, 0's: 0 Z-trim(117.6): 2 B-trim: 647 in 1/53 Lambda= 0.102306 statistics sampled from 18366 (18368) to 18366 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.859), E-opt: 0.2 (0.564), width: 16 Scan time: 2.110 The best scores are: opt bits E(32554) CCDS76853.1 INO80E gene_id:283899|Hs108|chr16 ( 205) 872 138.6 1.7e-33 CCDS10665.1 INO80E gene_id:283899|Hs108|chr16 ( 244) 872 138.7 2e-33 >>CCDS76853.1 INO80E gene_id:283899|Hs108|chr16 (205 aa) initn: 872 init1: 872 opt: 872 Z-score: 714.8 bits: 138.6 E(32554): 1.7e-33 Smith-Waterman score: 872; 100.0% identity (100.0% similar) in 132 aa overlap (1-132:1-132) 10 20 30 40 50 60 pF1KE1 MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS76 MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQY 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 ENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS76 ENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPL 70 80 90 100 110 120 130 pF1KE1 QASGVPSPYLSSERGQA :::::::::::: CCDS76 QASGVPSPYLSSMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPR 130 140 150 160 170 180 >>CCDS10665.1 INO80E gene_id:283899|Hs108|chr16 (244 aa) initn: 872 init1: 872 opt: 872 Z-score: 713.7 bits: 138.7 E(32554): 2e-33 Smith-Waterman score: 872; 100.0% identity (100.0% similar) in 132 aa overlap (1-132:1-132) 10 20 30 40 50 60 pF1KE1 MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQY 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 ENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 ENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPL 70 80 90 100 110 120 130 pF1KE1 QASGVPSPYLSSERGQA :::::::::::: CCDS10 QASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCP 130 140 150 160 170 180 137 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 04:11:11 2016 done: Mon Nov 7 04:11:11 2016 Total Scan time: 2.110 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]