hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data/Pfam.bin Sequence file: /tmp/20080307/iprscan-20080307-03591234/chunk_1/iprscan-20080307-03591234.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pF1KB7515 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00170.11.fs bZIP transcription factor 51.4 6.1e-14 1 PF00170.11.ls bZIP transcription factor 53.4 7.1e-13 1 PF07716.5.fs Basic region leucine zipper 43.3 7.5e-11 1 PF07716.5.ls Basic region leucine zipper 45.3 1.9e-10 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00170.11.fs 1/1 33 97 .. 1 65 [] 51.4 6.1e-14 PF07716.5.fs 1/1 33 87 .. 1 57 [] 43.3 7.5e-11 PF00170.11.ls 1/1 33 97 .. 1 65 [] 53.4 7.1e-13 PF07716.5.ls 1/1 33 87 .. 1 57 [] 45.3 1.9e-10 Alignments of top-scoring domains: PF00170.11.fs: domain 1 of 1, from 33 to 97: score 51.4, E = 6.1e-14 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk e ++++ rR++kNR+AA+rsR++ ++ ++L e+ e+Le eN++Lr pF1KB7515 33 EDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRR 79 elerLkkevakLksenee<-* e+ +L++e + L+ ++e pF1KB7515 80 EIGKLTEELKHLTEALKE 97 PF07716.5.fs: domain 1 of 1, from 33 to 87: score 43.3, E = 7.5e-11 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk +dd++++rRr++N++AA+rsR+K q+ ++l e+ + Le+eN L pF1KB7515 33 EDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTML-- 77 rqkveqLekE<-* r+++ L+ E pF1KB7515 78 RREIGKLTEE 87 PF00170.11.ls: domain 1 of 1, from 33 to 97: score 53.4, E = 7.1e-13 *->ekelKrerRkqkNReAArrsRlRKqaeieeLeekveeLeaeNkaLrk e ++++ rR++kNR+AA+rsR++ ++ ++L e+ e+Le eN++Lr pF1KB7515 33 EDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRR 79 elerLkkevakLksenee<-* e+ +L++e + L+ ++e pF1KB7515 80 EIGKLTEELKHLTEALKE 97 PF07716.5.ls: domain 1 of 1, from 33 to 87: score 45.3, E = 1.9e-10 *->kddeyrdrRrlrNneAAkrsReKkKqreeeleervkeLeeeNaqLLk +dd++++rRr++N++AA+rsR+K q+ ++l e+ + Le+eN L pF1KB7515 33 EDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTML-- 77 rqkveqLekE<-* r+++ L+ E pF1KB7515 78 RREIGKLTEE 87 //