FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB7501, 58 aa
  1>>>pF1KB7501 58 - 58 aa - 58 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6556+/-0.000214; mu= 9.5555+/- 0.013
 mean_var=61.0903+/-12.901, 0's: 0 Z-trim(124.7): 1  B-trim: 30 in 1/57
 Lambda= 0.164092
 statistics sampled from 46807 (46808) to 46807 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.887), E-opt: 0.2 (0.549), width:  16
 Scan time:  3.190

The best scores are:                                      opt bits E(85289)
NP_005025 (OMIM: 606033) DNA-directed RNA polymera (  58)  417 105.4 5.4e-24


>>NP_005025 (OMIM: 606033) DNA-directed RNA polymerases   (58 aa)
 initn: 417 init1: 417 opt: 417  Z-score: 551.8  bits: 105.4 E(85289): 5.4e-24
Smith-Waterman score: 417; 100.0% identity (100.0% similar) in 58 aa overlap (1-58:1-58)

               10        20        30        40        50        
pF1KB7 MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_005 MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
               10        20        30        40        50        




58 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 07:58:42 2016 done: Fri Nov  4 07:58:43 2016
 Total Scan time:  3.190 Total Display time:  0.000

Function used was FASTA [36.3.4 Apr, 2011]