FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6593, 51 aa
  1>>>pF1KE6593 51 - 51 aa - 51 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.2152+/-0.000295; mu= 8.8690+/- 0.018
 mean_var=34.1050+/- 6.693, 0's: 0 Z-trim(116.4): 15  B-trim: 338 in 2/53
 Lambda= 0.219617
 statistics sampled from 27545 (27553) to 27545 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.759), E-opt: 0.2 (0.323), width:  16
 Scan time:  2.480

The best scores are:                                      opt bits E(85289)
NP_008817 (OMIM: 606153,614053) ATP synthase subun (  51)  321 107.5   1e-24


>>NP_008817 (OMIM: 606153,614053) ATP synthase subunit e  (51 aa)
 initn: 321 init1: 321 opt: 321  Z-score: 564.9  bits: 107.5 E(85289): 1e-24
Smith-Waterman score: 321; 100.0% identity (100.0% similar) in 51 aa overlap (1-51:1-51)

               10        20        30        40        50 
pF1KE6 MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
       :::::::::::::::::::::::::::::::::::::::::::::::::::
NP_008 MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
               10        20        30        40        50 




51 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:39:13 2016 done: Tue Nov  8 14:39:13 2016
 Total Scan time:  2.480 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]