FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6547, 101 aa
  1>>>pF1KE6547 101 - 101 aa - 101 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.9960+/-0.000283; mu= 11.6728+/- 0.018
 mean_var=59.8672+/-11.654, 0's: 0 Z-trim(118.2): 2  B-trim: 35 in 1/53
 Lambda= 0.165760
 statistics sampled from 30856 (30857) to 30856 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.752), E-opt: 0.2 (0.362), width:  16
 Scan time:  3.910

The best scores are:                                      opt bits E(85289)
NP_000474 (OMIM: 207750,608083) apolipoprotein C-I ( 101)  629 157.7 2.9e-39


>>NP_000474 (OMIM: 207750,608083) apolipoprotein C-II pr  (101 aa)
 initn: 629 init1: 629 opt: 629  Z-score: 826.0  bits: 157.7 E(85289): 2.9e-39
Smith-Waterman score: 629; 99.0% identity (100.0% similar) in 101 aa overlap (1-101:1-101)

               10        20        30        40        50        60
pF1KE6 MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYE
       :::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::
NP_000 MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYE
               10        20        30        40        50        60

               70        80        90       100 
pF1KE6 KTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
       :::::::::::::::::::::::::::::::::::::::::
NP_000 KTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
               70        80        90       100 




101 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:18:03 2016 done: Tue Nov  8 14:18:03 2016
 Total Scan time:  3.910 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]