FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6547, 101 aa
  1>>>pF1KE6547 101 - 101 aa - 101 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0988+/-0.000602; mu= 10.9023+/- 0.037
 mean_var=58.8181+/-11.584, 0's: 0 Z-trim(111.1): 2  B-trim: 82 in 2/49
 Lambda= 0.167232
 statistics sampled from 12133 (12134) to 12133 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.762), E-opt: 0.2 (0.373), width:  16
 Scan time:  1.370

The best scores are:                                      opt bits E(32554)
CCDS12650.1 APOC2 gene_id:344|Hs108|chr19          ( 101)  629 159.0 4.5e-40


>>CCDS12650.1 APOC2 gene_id:344|Hs108|chr19               (101 aa)
 initn: 629 init1: 629 opt: 629  Z-score: 833.0  bits: 159.0 E(32554): 4.5e-40
Smith-Waterman score: 629; 99.0% identity (100.0% similar) in 101 aa overlap (1-101:1-101)

               10        20        30        40        50        60
pF1KE6 MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYE
       :::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::
CCDS12 MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYE
               10        20        30        40        50        60

               70        80        90       100 
pF1KE6 KTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
       :::::::::::::::::::::::::::::::::::::::::
CCDS12 KTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
               70        80        90       100 




101 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:18:02 2016 done: Tue Nov  8 14:18:02 2016
 Total Scan time:  1.370 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]