FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6545, 101 aa 1>>>pF1KE6545 101 - 101 aa - 101 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.1678+/-0.000304; mu= 11.3338+/- 0.019 mean_var=82.3622+/-16.788, 0's: 0 Z-trim(119.0): 9 B-trim: 479 in 1/49 Lambda= 0.141322 statistics sampled from 32480 (32488) to 32480 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.761), E-opt: 0.2 (0.381), width: 16 Scan time: 3.530 The best scores are: opt bits E(85289) NP_054890 (OMIM: 604594,615789) cysteine-rich PDZ- ( 101) 710 153.1 7e-38 >>NP_054890 (OMIM: 604594,615789) cysteine-rich PDZ-bind (101 aa) initn: 710 init1: 710 opt: 710 Z-score: 801.1 bits: 153.1 E(85289): 7e-38 Smith-Waterman score: 710; 100.0% identity (100.0% similar) in 101 aa overlap (1-101:1-101) 10 20 30 40 50 60 pF1KE6 MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_054 MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRI 10 20 30 40 50 60 70 80 90 100 pF1KE6 CKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV ::::::::::::::::::::::::::::::::::::::::: NP_054 CKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV 70 80 90 100 101 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:16:57 2016 done: Tue Nov 8 14:16:58 2016 Total Scan time: 3.530 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]