FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6545, 101 aa
  1>>>pF1KE6545 101 - 101 aa - 101 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.1678+/-0.000304; mu= 11.3338+/- 0.019
 mean_var=82.3622+/-16.788, 0's: 0 Z-trim(119.0): 9  B-trim: 479 in 1/49
 Lambda= 0.141322
 statistics sampled from 32480 (32488) to 32480 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.761), E-opt: 0.2 (0.381), width:  16
 Scan time:  3.530

The best scores are:                                      opt bits E(85289)
NP_054890 (OMIM: 604594,615789) cysteine-rich PDZ- ( 101)  710 153.1   7e-38


>>NP_054890 (OMIM: 604594,615789) cysteine-rich PDZ-bind  (101 aa)
 initn: 710 init1: 710 opt: 710  Z-score: 801.1  bits: 153.1 E(85289): 7e-38
Smith-Waterman score: 710; 100.0% identity (100.0% similar) in 101 aa overlap (1-101:1-101)

               10        20        30        40        50        60
pF1KE6 MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_054 MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRI
               10        20        30        40        50        60

               70        80        90       100 
pF1KE6 CKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
       :::::::::::::::::::::::::::::::::::::::::
NP_054 CKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
               70        80        90       100 




101 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:16:57 2016 done: Tue Nov  8 14:16:58 2016
 Total Scan time:  3.530 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]