FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6192, 83 aa
  1>>>pF1KE6192 83 - 83 aa - 83 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0476+/-0.000551; mu= 8.8795+/- 0.033
 mean_var=47.9765+/- 9.312, 0's: 0 Z-trim(111.2): 4  B-trim: 0 in 0/52
 Lambda= 0.185165
 statistics sampled from 12179 (12182) to 12179 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.786), E-opt: 0.2 (0.374), width:  16
 Scan time:  1.120

The best scores are:                                      opt bits E(32554)
CCDS82020.1 COX4I1 gene_id:1327|Hs108|chr16        ( 139)  510 143.0 3.5e-35
CCDS10955.1 COX4I1 gene_id:1327|Hs108|chr16        ( 169)  510 143.0 4.2e-35


>>CCDS82020.1 COX4I1 gene_id:1327|Hs108|chr16             (139 aa)
 initn: 510 init1: 510 opt: 510  Z-score: 745.2  bits: 143.0 E(32554): 3.5e-35
Smith-Waterman score: 510; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:1-80)

               10        20        30        40        50        60
pF1KE6 MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS82 MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK
               10        20        30        40        50        60

               70        80                                        
pF1KE6 ALKEKEKASWSSLSMDEKVECGY                                     
       ::::::::::::::::::::                                        
CCDS82 ALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMW
               70        80        90       100       110       120

>>CCDS10955.1 COX4I1 gene_id:1327|Hs108|chr16             (169 aa)
 initn: 510 init1: 510 opt: 510  Z-score: 743.8  bits: 143.0 E(32554): 4.2e-35
Smith-Waterman score: 510; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:1-80)

               10        20        30        40        50        60
pF1KE6 MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK
               10        20        30        40        50        60

               70        80                                        
pF1KE6 ALKEKEKASWSSLSMDEKVECGY                                     
       ::::::::::::::::::::                                        
CCDS10 ALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMW
               70        80        90       100       110       120




83 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 10:13:41 2016 done: Tue Nov  8 10:13:41 2016
 Total Scan time:  1.120 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]