FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6170, 69 aa
  1>>>pF1KE6170 69 - 69 aa - 69 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.3770+/-0.000474; mu= 6.8726+/- 0.029
 mean_var=61.3816+/-11.971, 0's: 0 Z-trim(115.4): 2  B-trim: 0 in 0/51
 Lambda= 0.163702
 statistics sampled from 16001 (16003) to 16001 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.851), E-opt: 0.2 (0.492), width:  16
 Scan time:  1.100

The best scores are:                                      opt bits E(32554)
CCDS3337.1 ATP5I gene_id:521|Hs108|chr4            (  69)  435 109.8 1.4e-25


>>CCDS3337.1 ATP5I gene_id:521|Hs108|chr4                 (69 aa)
 initn: 435 init1: 435 opt: 435  Z-score: 572.9  bits: 109.8 E(32554): 1.4e-25
Smith-Waterman score: 435; 100.0% identity (100.0% similar) in 69 aa overlap (1-69:1-69)

               10        20        30        40        50        60
pF1KE6 MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARE
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS33 MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARE
               10        20        30        40        50        60

                
pF1KE6 LAEDDSILK
       :::::::::
CCDS33 LAEDDSILK
                




69 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 10:02:40 2016 done: Tue Nov  8 10:02:40 2016
 Total Scan time:  1.100 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]