FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6160, 116 aa
  1>>>pF1KE6160 116 - 116 aa - 116 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.9829+/-0.000471; mu= 12.8199+/- 0.029
 mean_var=63.0438+/-12.355, 0's: 0 Z-trim(116.2): 5  B-trim: 0 in 0/53
 Lambda= 0.161530
 statistics sampled from 16832 (16836) to 16832 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.847), E-opt: 0.2 (0.517), width:  16
 Scan time:  1.520

The best scores are:                                      opt bits E(32554)
CCDS12940.1 GALP gene_id:85569|Hs108|chr19         ( 116)  779 188.5 7.7e-49


>>CCDS12940.1 GALP gene_id:85569|Hs108|chr19              (116 aa)
 initn: 779 init1: 779 opt: 779  Z-score: 990.3  bits: 188.5 E(32554): 7.7e-49
Smith-Waterman score: 779; 100.0% identity (100.0% similar) in 116 aa overlap (1-116:1-116)

               10        20        30        40        50        60
pF1KE6 MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRE
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRE
               10        20        30        40        50        60

               70        80        90       100       110      
pF1KE6 TALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 TALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS
               70        80        90       100       110      




116 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:58:23 2016 done: Tue Nov  8 09:58:23 2016
 Total Scan time:  1.520 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]