FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6152, 51 aa
  1>>>pF1KE6152 51 - 51 aa - 51 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.2387+/-0.000268; mu= 9.7175+/- 0.017
 mean_var=44.5585+/- 8.822, 0's: 0 Z-trim(118.9): 10  B-trim: 288 in 1/54
 Lambda= 0.192136
 statistics sampled from 32359 (32369) to 32359 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.79), E-opt: 0.2 (0.38), width:  16
 Scan time:  2.580

The best scores are:                                      opt bits E(85289)
NP_000191 (OMIM: 142702) histatin-3 precursor [Hom (  51)  353 104.1   1e-23
NP_002150 (OMIM: 142701) histatin-1 precursor [Hom (  57)  285 85.3 5.2e-18
NP_001009181 (OMIM: 184470) statherin isoform b pr (  52)  118 39.0 0.00042
NP_003145 (OMIM: 184470) statherin isoform a precu (  62)  108 36.3  0.0033


>>NP_000191 (OMIM: 142702) histatin-3 precursor [Homo sa  (51 aa)
 initn: 353 init1: 353 opt: 353  Z-score: 546.9  bits: 104.1 E(85289): 1e-23
Smith-Waterman score: 353; 100.0% identity (100.0% similar) in 51 aa overlap (1-51:1-51)

               10        20        30        40        50 
pF1KE6 MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
       :::::::::::::::::::::::::::::::::::::::::::::::::::
NP_000 MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
               10        20        30        40        50 

>>NP_002150 (OMIM: 142701) histatin-1 precursor [Homo sa  (57 aa)
 initn: 333 init1: 256 opt: 285  Z-score: 444.3  bits: 85.3 E(85289): 5.2e-18
Smith-Waterman score: 285; 75.4% identity (82.5% similar) in 57 aa overlap (1-51:1-57)

               10        20        30        40              50 
pF1KE6 MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHR------GYRSNYLYDN
       ::::::::.::::.:: .:::: ::::::.:::::::::::       : :::::::
NP_002 MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
               10        20        30        40        50       

>>NP_001009181 (OMIM: 184470) statherin isoform b precur  (52 aa)
 initn: 117 init1: 112 opt: 118  Z-score: 194.7  bits: 39.0 E(85289): 0.00042
Smith-Waterman score: 118; 44.7% identity (66.0% similar) in 47 aa overlap (1-47:1-47)

               10        20        30        40        50  
pF1KE6 MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN 
       :::.:::.:::::.:: ::::  .  .:  .   :.    . :. .:     
NP_001 MKFLVFAFILALMVSMIGADSSEEYGYGPYQPVPEQPLYPQPYQPQYQQYTF
               10        20        30        40        50  

>>NP_003145 (OMIM: 184470) statherin isoform a precursor  (62 aa)
 initn: 112 init1: 108 opt: 108  Z-score: 178.6  bits: 36.3 E(85289): 0.0033
Smith-Waterman score: 108; 68.0% identity (88.0% similar) in 25 aa overlap (1-25:1-25)

               10        20        30        40        50          
pF1KE6 MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN         
       :::.:::.:::::.:: ::::  ..                                   
NP_003 MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQY
               10        20        30        40        50        60




51 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:54:24 2016 done: Tue Nov  8 09:54:25 2016
 Total Scan time:  2.580 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]