FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE6146, 98 aa
1>>>pF1KE6146 98 - 98 aa - 98 aa
Library: human.CCDS.faa
18511270 residues in 32554 sequences
Statistics: Expectation_n fit: rho(ln(x))= 4.8595+/-0.000592; mu= 11.3113+/- 0.036
mean_var=52.4120+/-10.634, 0's: 0 Z-trim(110.5): 10 B-trim: 2 in 1/51
Lambda= 0.177157
statistics sampled from 11632 (11637) to 11632 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.76), E-opt: 0.2 (0.357), width: 16
Scan time: 1.310
The best scores are: opt bits E(32554)
CCDS2336.1 NDUFB3 gene_id:4709|Hs108|chr2 ( 98) 701 186.1 2.9e-48
>>CCDS2336.1 NDUFB3 gene_id:4709|Hs108|chr2 (98 aa)
initn: 701 init1: 701 opt: 701 Z-score: 979.9 bits: 186.1 E(32554): 2.9e-48
Smith-Waterman score: 701; 100.0% identity (100.0% similar) in 98 aa overlap (1-98:1-98)
10 20 30 40 50 60
pF1KE6 MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKS
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS23 MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKS
10 20 30 40 50 60
70 80 90
pF1KE6 VSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
::::::::::::::::::::::::::::::::::::::
CCDS23 VSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
70 80 90
98 residues in 1 query sequences
18511270 residues in 32554 library sequences
Tcomplib [36.3.4 Apr, 2011] (8 proc)
start: Tue Nov 8 09:51:25 2016 done: Tue Nov 8 09:51:26 2016
Total Scan time: 1.310 Total Display time: -0.020
Function used was FASTA [36.3.4 Apr, 2011]